KEGG   Methylibium petroleiphilum: Mpe_A3665Help
Entry
Mpe_A3665         CDS       T00470                                 

Definition
ATP:glycerol 3-phosphotransferase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mpt  Methylibium petroleiphilum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mpt00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3875975..3877474
Genome map
AA seq 499 aa AA seqDB search
MTYLLALDQGTSSSRSIVFDRGGRIRAMAQREFRQLYPQPGWVEHDPMEIWETQLATARE
ALAQAGLTASDIAAIGITNQRETTLLWERASGRPIANAIVWQDRRTEPLCARWREQGLAD
AVRDVTGLVIDPYFSASKIAWLLDHVPGARTRAERGELAFGTVDSWLLRQLTGGRVHATD
TTNASRTMLFDIDRGAWSEPLLAALDIPRALLPAVQQSASHFGDTEPALLGHAVPVCGIA
GDQQAALFGQAGFQAGLAKNTYGTGCFLLMHTGAQRQASTHGLITTAAAQVDSTAPRQYA
LEGSVFIGGAVVQWLRDGLHAIRGSGEVQALAESVPDAGGVVVVPAFTGLGAPYWRPEAS
GAIVGLTRGSTVAHIARAALESIAFQSAALLDAMSRDAVAAGGQPVSELRVDGGACVNDL
LMQFQADLLGIPVVRPQVIETTALGAACLAGLGCGLYAGTDELAAQWQAERRFLPTMPRE
RAAERMARWERAVRQTVAP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgacctacctgctcgccctcgaccagggcacctccagctcgcgcagcatcgtgttcgac
cgcggaggccgcatccgcgcgatggcgcagcgcgagttccgccagctctacccgcaaccg
ggctgggtggagcacgacccgatggagatctgggagacccagctcgccacggcccgcgag
gcgctggcccaggcggggttgacggcgtccgacatcgcggccatcggtatcaccaaccag
cgcgagaccacgctgctgtgggaacgtgcgagcggccggccgatcgccaacgccatcgtc
tggcaggaccgccgcaccgagcccctgtgcgcgcgctggcgcgagcagggtctggccgat
gcggtgcgcgacgtgaccggcctggtcatcgacccctacttctcggccagcaagatcgcg
tggctgctcgaccacgtgccgggcgcccgcacgcgagccgagcgcggcgagctggccttc
ggcacggtggacagctggctgctgcggcagctgaccggcggccgtgtgcacgccaccgac
accaccaacgcctcgcgcacgatgctgttcgacatcgaccgcggcgcctggagcgagccg
ctgctggcggcgctggacatcccgcgcgcgctgctgccggcagtgcagcagtctgcctcg
catttcggcgacaccgagcccgcgctgctgggccatgccgtgccggtgtgcggcatcgcc
ggcgaccagcaggccgcgctgttcggccaagccggcttccaggccgggctggcgaagaac
acctacggcaccggctgcttcctgctgatgcacaccggcgcacagcggcaggcctcgacc
cacggcctgatcaccaccgcggcggcgcaggtggacagcacggcaccgcgccagtacgcg
ctggagggcagcgtgttcatcggcggcgcggtggtgcagtggctgcgtgatggcttgcac
gcgatccgcggcagcggcgaggtgcaggcgctggccgagagcgtgcccgacgccggcggc
gtggtggtggtgccggccttcaccggcctgggcgccccctactggcggccggaggccagc
ggcgcgatcgtcggcctgacgcgcggcagcacggtggcccacatcgcgcgcgcggcgctg
gagagcatcgcgttccagagcgcggcgctgctcgacgcgatgagccgcgacgcggtggcc
gccggcgggcagccggtcagcgagctgcgcgtcgacggcggtgcctgcgtcaacgacctg
ctgatgcagttccaggccgacctgctgggcattccggtcgtgcggccgcaggtgatcgag
accacggccctcggcgcggcgtgcctggccggactgggctgtggcctctacgccggcacc
gacgagctggcggcgcagtggcaggccgagcgacgcttcctgccgacgatgccgcgcgag
cgcgcggcggagcggatggcgcgctgggaacgcgcggtgcgccagacggtcgctccctga

DBGET integrated database retrieval system