KEGG   Methylibium petroleiphilum: Mpe_A3685Help
Entry
Mpe_A3685         CDS       T00470                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mpt  Methylibium petroleiphilum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mpt00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mpt00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3895914..3896405)
Genome map
AA seq 163 aa AA seqDB search
MITTTIYDFEARSIDGRTVSLADYRGKVLLIVNTASACGFTPQFAGLQSLWQAYGERGLA
VLGFPSNEFGGQDPGSNDEIASFCQLNYGVSFPMMAKVEVNGAGAHPLYRWLTGEVKGLL
GTRAIKWNFTKFLVGRDGRVLGRYAPTDKPESLTRDIEAALAA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccaccacgatctacgatttcgaggcccggtccatcgacggccggaccgtctcg
ctggccgactaccgcggcaaggtgctgctgatcgtcaacaccgccagcgcctgcggcttc
acgccgcagttcgccggtctccagtcgctgtggcaggcctacggcgagcgtgggctggcg
gtcctcggctttccgagcaacgagttcggcgggcaggatcccggcagcaacgacgagatt
gccagcttctgccagctgaactacggcgtcagcttcccgatgatggccaaggtcgaggtc
aacggcgccggtgcccatccgctctaccggtggctcaccggcgaggtcaagggcctgctc
gggacgcgggcgatcaagtggaacttcaccaagttcctcgtcgggcgcgacggccgcgtc
ctcgggcgctatgcgccgaccgacaagcccgagagcctgacgcgcgacatcgaggccgcg
ctcgccgcctga

DBGET integrated database retrieval system