KEGG   Mycoplasma pulmonis: MYPU_2210Help
Entry
MYPU_2210         CDS       T00055                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mpu  Mycoplasma pulmonis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mpu00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
253360..254883
Genome map
AA seq 507 aa AA seqDB search
MENNEKYIITLDSGTTSCRSLIVNKKGEIIAIAQNEFSQYFPKSGWVEHDPLEIWNTQLS
TMQSVKNKAQIKSSDIVALGITNQRETIVVWDKDTGLPVYNAIVWQDVRTSSFCDQMIAE
NKTEFFREKTGLIINPYFSATKLKWILENVPLAKEKLAKGKLLAGTIDTWLIWKLTGGKV
HASDVSNASRTMLFNIHSLDWDQEILDYLKIPRSILPKVQASSEFYGFVQSSLWSNKAKG
KVPITGVAGDQQSALFGQMCTEVGMVKNTYGTGCFTLVNTGQKPVNSKNRLLTTIAWKLG
NEKTIYALEGSVFVAGAAIQWLRDSLRILYNAALSDFYSSLVKDNQRVYVVPAFTGLGAP
YWDSYAKGAIFGLERGTKNEHIIKATLESIAYQSNDLIKAMEKDLGQKITLLKVDGGASK
SDYLMNFQASISNLDVHRPANVETTALGAAYLAGLAVGFWKDIKEIQKMIKIDHQFKPSV
DQKEVDVLLKGWNEAVKRVLNWQKDIE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataacgaaaaatatattattacattggattcaggaactacatcgtgtcgttca
ttaattgttaataaaaaaggtgaaattattgccattgctcaaaatgaatttagtcaatat
tttcctaaatcaggttgagttgaacatgaccctttagaaatttgaaatactcaactttca
actatgcaaagtgtaaaaaacaaagcccaaattaaatcaagtgatattgtggctttaggt
attaccaaccaaagagaaactattgttgtttgagataaagacacaggcttgcctgtttat
aatgccatagtttgacaagatgtaagaacttcaagcttttgtgatcagatgatagctgaa
aataaaactgagttttttagagaaaaaacaggactaattattaatccatattttagtgct
actaaattaaaatgaattttagaaaacgttcctttagccaaagaaaaattggctaaagga
aaacttttagcaggaacaattgatacttggttgatttggaaattaactggtggaaaagtt
catgctagcgatgtttcaaatgcttcaagaactatgctttttaacatccatagccttgat
tgagatcaagagattctagattatttaaaaattccaagaagcatcttacctaaagttcag
gcctcttctgaattttatggctttgttcaaagcagtctgtggtcaaataaagccaagggg
aaagttccaattactggagtagcaggagatcaacaatcagctttatttggtcaaatgtgc
actgaagtaggaatggtaaaaaacacttatggaacaggatgttttactttggttaacact
ggtcaaaaaccagttaattctaaaaatagacttttaacaacaatagcttgaaaattaggt
aatgaaaaaacaatttatgccttagaaggttcagtttttgtagcaggagctgctattcaa
tgactaagagattcactaaggattttatataatgcagctttaagtgatttttatagctcc
ttggtaaaagataaccaaagagtctatgttgttccagcttttactggactaggagctcca
tattgagattcttatgctaaaggagcaatttttggccttgaaagaggaactaaaaatgaa
catattattaaagctactttagagtcaatagcttatcaaagtaatgacttaattaaagct
atggaaaaagacttaggtcaaaaaataactttacttaaagtagatggaggagctagcaag
tctgattatttaatgaactttcaagcatctatttcaaatttagatgttcatagaccagcc
aatgtagaaactactgccctaggagctgcttatttagctggattggccgttggtttttga
aaagatataaaagaaattcaaaaaatgatcaaaattgatcatcagttcaaaccttctgtt
gatcaaaaagaagttgatgttttattaaaaggatgaaatgaagctgtaaaaagagtttta
aactgacaaaaggacattgaataa

DBGET integrated database retrieval system