KEGG   Mycoplasma pulmonis: MYPU_2280Help
Entry
MYPU_2280         CDS       T00055                                 

Gene name
glcK
Definition
(RefSeq) glucokinase (glucose kinase) (EC:2.7.1.2)
  KO
K00845  
glucokinase [EC:2.7.1.2]
Organism
mpu  Mycoplasma pulmonis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mpu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYPU_2280 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYPU_2280 (glcK)
   00052 Galactose metabolism
    MYPU_2280 (glcK)
   00500 Starch and sucrose metabolism
    MYPU_2280 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    MYPU_2280 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MYPU_2280 (glcK)
   00524 Butirosin and neomycin biosynthesis
    MYPU_2280 (glcK)
Enzymes [BR:mpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MYPU_2280 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
262416..263279
Genome map
AA seq 287 aa AA seqDB search
MKIIAIDIGGTNTRVALYDESLKKLDYKKITSHPRNYEETMNQVVEFINGHQGVEAIGIS
APGPADYQKGVFFNLPNLPGWRNFHFIDFLKQKTNVKNIKAQNDANLMALAHHYHFKRTK
DDVTQFFTVSTGIGAGLIIENKIFAGSKGFGQEIANLPAAWNKESGFGYGQGSIELYASG
KGLSLRSNMKAQELLSKYNYEDNKIIEEAIESLANLIAISAAFVNPNLIVFDGSVARYNK
WYIMKAIEISRKRMFESQWNSLEFKFSELDDDAALIGAFHLVTKNNS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatagccatagacattggaggaacaaacactagagttgccctttatgatgag
agcttaaaaaaactagattataaaaaaataacttcccatccaagaaactatgaagagact
atgaaccaagtagttgaatttatcaatggccatcaaggagttgaggcaataggaatttca
gctccaggaccagctgattatcaaaaaggagttttctttaatttacctaatcttccaggt
tgaagaaattttcattttattgattttttaaaacaaaaaactaatgtaaaaaatattaaa
gcacaaaatgatgctaatttaatggcccttgctcatcactatcattttaaaagaacaaaa
gatgatgttacacaattttttacagtctcaacgggtataggagctggactaataattgag
aataaaatttttgcaggatcaaaaggctttggtcaagaaattgcaaacttaccagctgct
tgaaataaagaaagtggctttggttatggacaaggttcaattgaactttatgcctctggt
aaaggactaagtctaagatcaaatatgaaggcacaagagcttctttcaaagtacaactat
gaagataataaaattattgaagaggccattgaatcacttgcaaatttgattgccataagt
gctgcttttgtaaatcctaatttaatagtttttgacggttcagttgctcgttacaacaaa
tgatacataatgaaggcaatagaaatttcaagaaaaagaatgtttgaaagtcaatggaat
tcacttgaatttaaattttctgaattagatgatgatgctgccttgattggtgcttttcat
cttgtaacaaaaaataactcttaa

DBGET integrated database retrieval system