KEGG   Mycoplasma pulmonis: MYPU_2280Help
Entry
MYPU_2280         CDS       T00055                                 

Gene name
glcK
Definition
glucokinase (glucose kinase) (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mpu  Mycoplasma pulmonis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mpu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYPU_2280 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYPU_2280 (glcK)
   00052 Galactose metabolism
    MYPU_2280 (glcK)
   00500 Starch and sucrose metabolism
    MYPU_2280 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    MYPU_2280 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MYPU_2280 (glcK)
   00524 Butirosin and neomycin biosynthesis
    MYPU_2280 (glcK)
Enzymes [BR:mpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MYPU_2280 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
262416..263279
Genome map
AA seq 287 aa AA seqDB search
MKIIAIDIGGTNTRVALYDESLKKLDYKKITSHPRNYEETMNQVVEFINGHQGVEAIGIS
APGPADYQKGVFFNLPNLPGWRNFHFIDFLKQKTNVKNIKAQNDANLMALAHHYHFKRTK
DDVTQFFTVSTGIGAGLIIENKIFAGSKGFGQEIANLPAAWNKESGFGYGQGSIELYASG
KGLSLRSNMKAQELLSKYNYEDNKIIEEAIESLANLIAISAAFVNPNLIVFDGSVARYNK
WYIMKAIEISRKRMFESQWNSLEFKFSELDDDAALIGAFHLVTKNNS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatagccatagacattggaggaacaaacactagagttgccctttatgatgag
agcttaaaaaaactagattataaaaaaataacttcccatccaagaaactatgaagagact
atgaaccaagtagttgaatttatcaatggccatcaaggagttgaggcaataggaatttca
gctccaggaccagctgattatcaaaaaggagttttctttaatttacctaatcttccaggt
tgaagaaattttcattttattgattttttaaaacaaaaaactaatgtaaaaaatattaaa
gcacaaaatgatgctaatttaatggcccttgctcatcactatcattttaaaagaacaaaa
gatgatgttacacaattttttacagtctcaacgggtataggagctggactaataattgag
aataaaatttttgcaggatcaaaaggctttggtcaagaaattgcaaacttaccagctgct
tgaaataaagaaagtggctttggttatggacaaggttcaattgaactttatgcctctggt
aaaggactaagtctaagatcaaatatgaaggcacaagagcttctttcaaagtacaactat
gaagataataaaattattgaagaggccattgaatcacttgcaaatttgattgccataagt
gctgcttttgtaaatcctaatttaatagtttttgacggttcagttgctcgttacaacaaa
tgatacataatgaaggcaatagaaatttcaagaaaaagaatgtttgaaagtcaatggaat
tcacttgaatttaaattttctgaattagatgatgatgctgccttgattggtgcttttcat
cttgtaacaaaaaataactcttaa

DBGET integrated database retrieval system