KEGG   Mycoplasma pulmonis: MYPU_3890Help
Entry
MYPU_3890         CDS       T00055                                 

Gene name
lig
Definition
DNA ligase (polydeoxyribonucleotide synthase [NAD+]) (EC:6.5.1.2)
Orthology
K01972  
DNA ligase (NAD+) [EC:6.5.1.2]
Organism
mpu  Mycoplasma pulmonis
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:mpu03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mpu03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mpu03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:mpu03430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
456736..458775
Genome map
AA seq 679 aa AA seqDB search
MSLSKSKVKSKIKELNEKLKLYNHHYYNKNESLVSDEYYDAKLLELENIRDNFPEEYNQV
FQKDFSKSVLEKVNHLDEQDVKLKKEKHQKLMLSLNKAYSFEDLERYTNRINTFVGNNHQ
YILQEKIDGVSISLYYENGILTKALTRGDGIYGENVTHNALNIKDIPKTINIKENIELRG
EIFFSLKLFESLKNEFLDKQDGTKNKKWNTPRNKASGILKSLKTTDESSWLSCFIYEVVS
PENFNLKTQKQLFDFLKIQGFNLPKFEFIENENLIENFITNFKFEDDQRDYEIDGLVIKL
NDLSLYDLLGKTSKFFHHSIAYKFRKKFVMTKIEDIFVTVGRTGLITYNAKLQEVVLNGS
KIKAATLHNYEYIKNIKINIGDKVYIEKAGEIIPRVVKLVSPKNDQNYFSPIEFCPSCKN
KLSWSENMLNQFCLNPDCIEKKIQKLKYFVSKDGMEIQELGGKKIELFFAKGWVKKIEDI
YNLKNNYDDLLKLENFQEHSVNVLLHKIEESKDVYTWKLIAALGIKNIGKKLAKSLVKII
FENDQKNLLSLLEFNYDELEKYDEFGSVKIESLKEFFANDENRNLIQFLDQNGFELKMEK
EIIQSTKLENKTFLITGTLEKPRDFYKNLIIQNGGIISSSISKKLDYLIVGQNPGSKEKK
AMELNIKIIDEEFLKKMLE
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgtcaaaatcaaaagttaaatctaaaattaaagaattaaatgaaaaattaaaa
ctttataaccatcattattacaataaaaatgaatcccttgtttctgatgaatactatgat
gcaaaacttcttgaattagaaaatataagagataactttcctgaagaatataatcaagtt
tttcaaaaagatttttcaaaaagtgtacttgaaaaagttaaccatcttgatgaacaagat
gttaaattaaaaaaagaaaagcatcaaaaattgatgctttctttaaataaagcttactca
tttgaagatcttgaaagatacacaaatcgcattaacacttttgttggtaataaccatcaa
tacatccttcaagaaaaaatagatggagtttctatttcactttattacgaaaatggaatt
ttaacaaaagctttaactagaggtgatggaatttatggtgaaaatgtcactcataatgca
ctaaatattaaagacattccaaagacaattaatatcaaagaaaacattgaacttagaggt
gaaattttctttagtcttaaactttttgaatctctaaaaaatgaatttttagataagcaa
gatggaacaaaaaacaaaaagtgaaatacaccaagaaataaagctagtggtattttaaaa
agtttaaaaacaactgatgaaagctcttgactttcttgctttatttatgaggtagttagc
cctgaaaatttcaatttaaaaactcaaaaacaactatttgattttttaaaaattcaagga
tttaatttacctaaatttgagtttatagaaaatgaaaatttaatagaaaatttcatcaca
aattttaaatttgaagatgatcaaagagactatgaaattgacggacttgtaattaaatta
aatgatcttagtttgtatgatcttttaggaaaaacttcaaagttttttcaccattcaata
gcttataaatttagaaaaaaatttgtaatgacaaaaattgaagacatctttgtaacagtt
ggtagaactggtttaattacttacaatgcaaaacttcaagaagttgttttaaatggttca
aaaatcaaagctgcaacgcttcataattatgaatatattaagaacataaaaattaatatt
ggtgataaagtctacattgaaaaagctggtgaaataatacctagagttgtaaaattagtt
agtcctaaaaatgatcaaaattactttagtccaattgagttttgtccttcatgtaaaaac
aaactttcatgatctgaaaacatgttaaatcagttttgtttaaatccagattgtattgag
aaaaaaattcaaaaactaaaatattttgtctcaaaagatggaatggaaattcaagagcta
ggtgggaaaaaaatagaacttttttttgctaaaggatgagttaaaaaaattgaggatatt
tacaatctaaaaaacaactatgatgatttgttaaaacttgaaaattttcaagaacattca
gtcaatgttttgcttcataaaattgaagagtcaaaagatgtttatacttgaaaattgata
gctgctttaggaataaaaaacataggaaaaaaacttgctaaatcacttgtaaaaatcatc
tttgaaaatgatcaaaaaaatcttttaagtcttttagaatttaactatgatgaattagaa
aaatatgatgaatttggaagtgtcaaaattgaatcactaaaagaattttttgcaaatgat
gaaaatagaaacttaattcaatttttagatcaaaatggctttgaattaaaaatggaaaaa
gaaataattcaatcaacaaaacttgaaaacaaaacttttttaattacaggaacccttgaa
aaaccaagagatttttataagaatttaattatccaaaatggaggaattatctcctcatca
atttcaaaaaaattagactatttaatagttggacaaaaccctggatcaaaagaaaaaaaa
gcaatggaattaaatatcaaaataattgatgaagaatttttaaaaaaaatgcttgagtag

DBGET integrated database retrieval system