KEGG   Mycoplasma pulmonis: MYPU_4580Help
Entry
MYPU_4580         CDS       T00055                                 

Gene name
MYPU_4580
Definition
(GenBank) TRIOSEPHOSPHATE ISOMERASE(TIM)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpu  Mycoplasma pulmonis
Pathway
mpu00010  Glycolysis / Gluconeogenesis
mpu00051  Fructose and mannose metabolism
mpu01100  Metabolic pathways
mpu01110  Biosynthesis of secondary metabolites
mpu01120  Microbial metabolism in diverse environments
mpu01130  Biosynthesis of antibiotics
mpu01200  Carbon metabolism
mpu01230  Biosynthesis of amino acids
Module
mpu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mpu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mpu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYPU_4580 (MYPU_4580)
   00051 Fructose and mannose metabolism
    MYPU_4580 (MYPU_4580)
   00562 Inositol phosphate metabolism
    MYPU_4580 (MYPU_4580)
Enzymes [BR:mpu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MYPU_4580 (MYPU_4580)
Exosome [BR:mpu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MYPU_4580 (MYPU_4580)
  Exosomal proteins of bladder cancer cells
   MYPU_4580 (MYPU_4580)
  Exosomal proteins of melanoma cells
   MYPU_4580 (MYPU_4580)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Rsbr_N
Motif
Other DBs
NCBI-ProteinID: CAC13631
UniProt: Q98QA8
Position
553094..553840
Genome map
AA seq 248 aa AA seqDB search
MKKLLIIGNWKMNKTYDEARDFINAFSNAYALNGAKISENIEYGIAPSFTNMSLFNKELL
EKTNINLVAQNINENRSGAFTGEISAQMLKSINAKYVIVGHSERRQNYRETNKIVNQKAK
AAIENGLIPIICVGESLEEYEAGKTKAVIKKQIKQSLEALDLSKIVVAYEPIWAIGTGKV
ATAEVAQQICKFIRSITSKDLIIQYGGSVSPSNIENLMKQEDIDGALVGGASLEVDSFFE
LITFNALK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacttttaattataggtaattgaaaaatgaacaaaacttatgatgaggcacgt
gattttatcaatgctttttctaatgcatatgcacttaatggagcaaaaatttctgaaaat
attgaatatggaattgccccgtcttttacaaatatgtcactttttaacaaagaattactt
gaaaaaactaacattaatttagtagctcaaaacataaatgaaaatcgaagtggagctttt
actggtgaaattagtgcacaaatgcttaaatcaattaatgccaaatatgttattgtaggt
catagcgaaagaagacaaaactatcgagaaactaacaaaattgttaatcaaaaagccaaa
gctgccattgaaaatggacttattccaattatttgtgttggagagagcttagaagaatat
gaagctggaaaaaccaaagctgttattaaaaaacaaattaaacaatctcttgaagctctt
gatctttctaaaattgttgttgcatatgagccaatttgagcaataggaactggaaaagta
gcaacagctgaagtagctcaacaaatttgtaagtttattagatcaattacctcaaaagat
ttaataattcaatatggaggaagtgttagtccatcaaatattgaaaatctaatgaaacaa
gaagatatagacggagctttagtaggaggagcttcattagaggttgatagtttttttgaa
ctaataacctttaatgctttaaagtaa

DBGET integrated database retrieval system