KEGG   Mycoplasma pulmonis: MYPU_5370Help
Entry
MYPU_5370         CDS       T00055                                 

Gene name
dhfR
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mpu  Mycoplasma pulmonis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYPU_5370 (dhfR)
   00670 One carbon pool by folate
    MYPU_5370 (dhfR)
Enzymes [BR:mpu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MYPU_5370 (dhfR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(661953..662492)
Genome map
AA seq 179 aa AA seqDB search
MTMNLIQLLKGKWRFKMIISIWAMTKEGLIGKDNQMPWHIKEEFQHFRRQTLHKTLIMGK
NTFFSLPKVFDKRKMYVLSHEKDFKIDHPDVEVIYDYKDLLKEYANNDKKDIYVAGGLYV
YQQLIPLSDILIVSIVKGSYEGNKYLSVDFSNFVQYKQPEIYDQFSVYYYKKKDQKNSI
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
ttgactatgaatttgatccaattattaaaggggaagtggcggtttaaaatgataatttca
atatgagctatgaccaaagaaggtctaatcggaaaagataaccaaatgccttgacacatt
aaggaagagtttcaacattttagaagacaaactttacataaaactttgataatgggaaaa
aacacttttttttctttaccaaaagtttttgataaaagaaaaatgtatgttttatctcat
gaaaaagattttaaaattgaccaccctgatgttgaggtcatttatgactataaagattta
cttaaagaatatgccaataatgacaaaaaagatatatatgtagcagggggtctttatgtt
tatcaacagttaatacctctttcagatattttaattgtttcaatagtaaaaggaagctat
gaaggcaataaatatttaagcgttgatttttcaaattttgtccaatataaacaaccagaa
atttacgatcaatttagtgtttattattacaaaaagaaagatcaaaaaaactctatttaa

DBGET integrated database retrieval system