KEGG   Mycoplasma pulmonis: MYPU_6460Help
Entry
MYPU_6460         CDS       T00055                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mpu  Mycoplasma pulmonis
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mpu00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
770151..771443
Genome map
AA seq 430 aa AA seqDB search
MRIVDLINKKMTGKALTKEEIDFLLDSYLNESMPDYQMAAFLMAVVFKSMEKEELAHFSL
KMLQSGKIIDLSSIKQIKVDKHSTGGIGDKTTLVIAPIIAALDLPVAKMSGRGLGHTGGT
LDKLESIPGFRINLSEEEFINQVKKINISVISQSQSLVPLDKKLYALRDVTATVESIPLI
ASSIMSKKLATGSDAILLDVKCGNGAFMKDIDRARELAKHMVDIGKVLNKDVVVEITNMD
RPLGKEIGNKNEVIEAIEALKDKWSWDFKELIYSSCINILLMTKKASTNQEAKTMIDSVI
KSGKALEKFYEFVQAQGGDVEILKSKSFWNPKFKLEIKANSNGYLNIYDALTFGIVAMKL
GAGRQTKEEKIDFEAGISLNKKTNDLVKKGDVIFSLYSSKPIDPSLIDELKNSWKISESK
VDFKMILDKF
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgtagatcttattaacaaaaaaatgaccggtaaagcactaacaaaagaagaa
attgattttttacttgatagttatttaaatgagagtatgccagattatcaaatggctgct
tttttaatggctgttgtttttaaatcaatggaaaaagaagaactggcccactttagttta
aagatgcttcaatcaggaaaaataattgatctttcatcaattaagcaaatcaaagtagat
aaacactcaactggaggaataggtgataaaacaactttggtaatagcccctattattgca
gctttagatttaccagtggctaaaatgagtggaagaggcctaggtcacactggaggaact
ttagataagcttgagtctattcctggatttagaattaatctttcagaagaagaatttatt
aatcaagttaaaaaaatcaatatctcagttattagtcaaagtcaaagccttgttcctctt
gataaaaaactctatgctcttagagatgttacagcaacagttgagtcaattcctttaatt
gcctcatctataatgtctaaaaaactagcaacaggctctgatgctattttactagatgta
aaatgtggtaatggcgcttttatgaaagatatagatagagcaagagagctagccaaacac
atggttgatataggaaaggttttaaacaaagatgttgttgttgaaattactaatatggac
aggcctttaggaaaagaaattggtaataaaaatgaagttatagaagcaatagaagctctt
aaagataagtgatcttgagactttaaagaacttatttatagctcatgtattaacattttg
ttaatgaccaaaaaagcctctacaaatcaagaggcaaaaactatgattgatagtgtcata
aaatctggaaaagctcttgaaaaattttatgaatttgtccaagctcaaggtggagatgtt
gagattctaaaatcgaaaagtttttgaaatccaaaatttaaattagaaattaaagccaat
agcaatggatatttaaatatttatgatgctttaacttttggaattgtagctatgaaatta
ggagctggtagacaaacaaaagaggaaaaaattgactttgaagctggtataagtttgaat
aaaaaaactaatgatttagttaaaaaaggtgatgttatttttagtttatattcatcaaag
cccattgatcctagcttaattgatgagctaaaaaattcttgaaaaataagtgagagcaaa
gttgattttaaaatgattttagataagttttaa

DBGET integrated database retrieval system