KEGG   Mycoplasma pulmonis: MYPU_7300Help
Entry
MYPU_7300         CDS       T00055                                 

Definition
aminopeptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mpu  Mycoplasma pulmonis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYPU_7300
Enzymes [BR:mpu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MYPU_7300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
891060..892163
Genome map
AA seq 367 aa AA seqDB search
MINFKEIMEKEKLFNRLKEYMELEAMSRYEEPVVEALRKNISKGFVSSRDGLGSLILKHE
KSKSNSPRIMVAAHMDEVGYTLREVETNGQVRLSAVGGIWPTVVIGTKAKLYVNATGKTY
DGVFGHTSIHIMDPAKFKEAIQTNDLYADFGFESKEKAEQLQVSAGDRVYLSGQTIRLHD
PNLVGGKAMDNRAGVTVLDYIAQHIQNVDLPNETFLVGTVQEEVGLRGAKASVGIVEPDI
AIALDTCASHDTLGAKQGIQKLGNGAALRIQDQGTMMDPKLVEFIFALAKKHNIPAYKYV
AQGGGTDAGELQFGKKGVATITISIPQRYLHSPIGVASLVDLKACGDLIVEFLKSFDKEA
FEKMKYK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattttaaggaaattatggaaaaagaaaaactgtttaatcgtttaaaagaatac
atggaacttgaggctatgtcaagatatgaagagcctgttgttgaggctttaagaaaaaat
atttcaaaaggttttgtctcttctagagatggtcttggttcgttgattttaaaacacgaa
aaatcaaaaagcaactctccaagaattatggttgcagctcacatggatgaagttggttat
acccttagagaagttgaaacaaatggccaagttagattaagtgctgttggaggaatttga
cctactgtagtaataggaacaaaagcaaaactttatgtaaatgccacaggaaaaacctat
gatggagtttttggtcatacatcaattcacattatggatccagctaaatttaaagaagct
attcaaacaaatgatttatatgctgattttggttttgaatcaaaagaaaaagcagagcaa
cttcaagttagtgctggggatagagtttatttaagtggacaaaccattagacttcatgat
cccaacttagtcggtggtaaggcaatggacaatagagcaggagttactgttttagattac
atagctcaacatattcaaaatgttgatttaccaaatgaaacttttttagttggaacagtt
caagaagaagttggtctaagaggagctaaagctagtgttggaattgttgaacctgatata
gcaatagcccttgatacatgtgcttctcatgatactcttggagcaaaacaaggaattcaa
aaattaggtaatggagctgctctaagaattcaagatcaagggacaatgatggatcctaaa
ttagttgaatttatttttgccttagccaaaaaacacaacatcccagcttataaatatgta
gcccaaggtggtggaactgatgctggtgagcttcagtttggaaaaaaaggtgtagctact
ataaccatctcaattcctcaaagatatcttcactcaccaataggtgttgcttctcttgtt
gatttaaaagcttgtggagatttaattgttgaatttttaaaatcttttgataaagaagct
tttgaaaaaatgaaatataaataa

DBGET integrated database retrieval system