KEGG   Mycoplasma pulmonis: MYPU_7300Help
Entry
MYPU_7300         CDS       T00055                                 

Gene name
MYPU_7300
Definition
(GenBank) AMINOPEPTIDASE
Organism
mpu  Mycoplasma pulmonis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
891060..892163
Genome map
AA seq 367 aa AA seqDB search
MINFKEIMEKEKLFNRLKEYMELEAMSRYEEPVVEALRKNISKGFVSSRDGLGSLILKHE
KSKSNSPRIMVAAHMDEVGYTLREVETNGQVRLSAVGGIWPTVVIGTKAKLYVNATGKTY
DGVFGHTSIHIMDPAKFKEAIQTNDLYADFGFESKEKAEQLQVSAGDRVYLSGQTIRLHD
PNLVGGKAMDNRAGVTVLDYIAQHIQNVDLPNETFLVGTVQEEVGLRGAKASVGIVEPDI
AIALDTCASHDTLGAKQGIQKLGNGAALRIQDQGTMMDPKLVEFIFALAKKHNIPAYKYV
AQGGGTDAGELQFGKKGVATITISIPQRYLHSPIGVASLVDLKACGDLIVEFLKSFDKEA
FEKMKYK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattttaaggaaattatggaaaaagaaaaactgtttaatcgtttaaaagaatac
atggaacttgaggctatgtcaagatatgaagagcctgttgttgaggctttaagaaaaaat
atttcaaaaggttttgtctcttctagagatggtcttggttcgttgattttaaaacacgaa
aaatcaaaaagcaactctccaagaattatggttgcagctcacatggatgaagttggttat
acccttagagaagttgaaacaaatggccaagttagattaagtgctgttggaggaatttga
cctactgtagtaataggaacaaaagcaaaactttatgtaaatgccacaggaaaaacctat
gatggagtttttggtcatacatcaattcacattatggatccagctaaatttaaagaagct
attcaaacaaatgatttatatgctgattttggttttgaatcaaaagaaaaagcagagcaa
cttcaagttagtgctggggatagagtttatttaagtggacaaaccattagacttcatgat
cccaacttagtcggtggtaaggcaatggacaatagagcaggagttactgttttagattac
atagctcaacatattcaaaatgttgatttaccaaatgaaacttttttagttggaacagtt
caagaagaagttggtctaagaggagctaaagctagtgttggaattgttgaacctgatata
gcaatagcccttgatacatgtgcttctcatgatactcttggagcaaaacaaggaattcaa
aaattaggtaatggagctgctctaagaattcaagatcaagggacaatgatggatcctaaa
ttagttgaatttatttttgccttagccaaaaaacacaacatcccagcttataaatatgta
gcccaaggtggtggaactgatgctggtgagcttcagtttggaaaaaaaggtgtagctact
ataaccatctcaattcctcaaagatatcttcactcaccaataggtgttgcttctcttgtt
gatttaaaagcttgtggagatttaattgttgaatttttaaaatcttttgataaagaagct
tttgaaaaaatgaaatataaataa

DBGET integrated database retrieval system