KEGG   Mycoplasma pulmonis: MYPU_7820Help
Entry
MYPU_7820         CDS       T00055                                 

Gene name
recD
Definition
exodeoxyribonuclease V alpha chain (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mpu  Mycoplasma pulmonis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mpu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(961795..963879)
Genome map
AA seq 694 aa AA seqDB search
MKITLKAIKKIWSSADQSASLFIFSDKEQKYRVFIKGFNVEEGLKYNLEIKPSNTYENSY
VCESLEFLDIIKKDEIIDFLHTKIKGVTKKEAEKIFEDYPIDTLDSILKDPSKLRIKDKK
KEEFLADLKLKIDGLEYKKYGIYNLFEKIKKLETKEPESQKLKNFYENPYSILSEDDFDF
NEIDTYFLKILKKPVDDLERLRSIILNCFKELYSTNSTKFAIQDIYKQSCKKIAFKKSDF
TFFLNDLIKQRKIILLKDKQFLAEAKMYDKEFFIVEKLKRLSKKRYSFNFNFEDKELSKE
QKEAATLCLKNSVSILTGYPGSGKTKTLKSILESIISDENKKVKKSNIAIMAPTGKAALQ
IFEKTGFEAKTIHSFLKLKPKATEVSFFDVDFDHIEILVIDEFSMVTVDLFFLILSTLSS
IKKIIIVGDHRQLPAIGAGNLLEDLLELQNISVNRLSQIFRNKTKDISENFLNVQKKIPF
ENNSENVNFIEANDTNFFDKISKLYFEDLSNYDVLEKTILIPFNKFETGAHKTNLHIQKK
LFKKNDLKNFAIGDKVMQIENNYEKGVYNGEIGIIEKFVEKVKDKDKEVYINFGDKKINY
SLEELNKNISLAYATTVHKFQGSESKIVIFVIFPILMNFLTRKMIYTAFSRAVDKLYIIG
SKSALNEVIMFSKDKKILTNISDFIKQSNNENIN
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattactttaaaggctattaagaaaatttgatctagcgctgaccagagtgcttca
ttgtttattttttcagataaagagcaaaaatatcgggtttttattaaaggctttaatgtt
gaagaaggtttaaaatacaatcttgaaataaagccttctaatacttatgaaaattcctat
gtttgtgagtcattagaatttttagatattattaaaaaagatgaaattattgatttttta
cacactaaaatcaaaggcgtaactaaaaaagaagctgaaaaaatttttgaggactatccc
attgacactttagattcaattttaaaagatccttcaaaattaaggataaaagataagaaa
aaggaagagtttttagctgatttaaaactaaaaattgatggacttgaatataaaaaatat
ggaatttataatttatttgaaaaaataaaaaaattagaaacaaaagagccagaaagccaa
aagttaaaaaacttttatgaaaatccatattcaattttatctgaagatgattttgacttt
aacgaaattgacacttactttctaaaaattctaaaaaaaccagtagatgatctagagaga
ttaagaagcataattcttaattgttttaaagagttatattcaacaaattcaacaaaattt
gccattcaagatatatataaacaatcatgtaaaaaaatagcttttaaaaaaagtgatttt
acattttttttaaatgatttaattaaacaaagaaaaattattttattaaaagataagcaa
tttttagctgaggctaaaatgtatgataaagaattttttattgttgaaaaactaaagaga
ttatcaaaaaaaagatactcatttaattttaattttgaagataaagaattaagtaaagaa
caaaaagaagctgcaactttatgtttaaaaaattctgtttcaattttaactggatatcca
ggaagtggaaaaacaaaaaccctaaaatcaatattagaatcaattattagtgatgaaaac
aaaaaagttaaaaaaagcaacattgcaatcatggcccccacaggaaaagcagcacttcaa
atttttgaaaaaacaggttttgaagcaaagacaattcacagttttttgaaactaaaacct
aaggctactgaagtatctttttttgatgtagattttgatcacatagagattttagtcatt
gatgaattttcaatggttacagtagatttattctttttgattttatcaactcttagttca
attaaaaaaattataatagttggagatcataggcaacttcctgccataggagctggaaat
ttacttgaggatttgttggaattacaaaatatatcagttaatagattaagtcaaattttt
agaaataaaactaaagatatttctgaaaattttttaaatgtccaaaagaaaattccattt
gaaaacaatagtgaaaatgttaattttatagaagctaatgatacaaatttttttgataaa
atttctaaattatattttgaagatttatcaaattatgatgttttagaaaaaacgatttta
attccttttaataaatttgaaacaggggctcataagacaaatttacatattcaaaaaaag
ctttttaaaaaaaatgatcttaagaattttgcaataggtgacaaagttatgcaaatagaa
aacaactatgaaaaaggtgtttataatggtgaaattggaatcattgaaaaatttgtagaa
aaagttaaagacaaagacaaagaagtttatataaattttggagataaaaaaattaactat
tctttagaagaattaaataaaaatatatcacttgcatatgctacaactgttcataaattt
caaggatctgaatcaaaaatagttatctttgttatatttccaattttgatgaatttttta
acaagaaagatgatttatacagcattttcaagagcagttgataaactatatataatagga
tctaaaagtgcattaaatgaagtgataatgttttcaaaagataaaaagattttgacaaac
ataagtgattttattaaacaaagcaacaatgaaaatattaattaa

DBGET integrated database retrieval system