KEGG   Mycoplasma putrefaciens Mput9231: MPUT9231_5460Help
Entry
MPUT9231_5460     CDS       T02637                                 

Gene name
fpg
Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mput  Mycoplasma putrefaciens Mput9231
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mput03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(653548..654375)
Genome map
AA seq 275 aa AA seqDB search
MPELPEVTTVVKVIKPKILNKTILGINIFTPKIVKSDSVDNFQKKVKNQKINKVFNKAKY
IVLELDEHVIISHLRMTGKWVVEQAETYSYDRSWLRAEISLDDQKFFRFYDARGFGTLDI
YDKKDYQIVSGLDQLGPIPLNNQVSVDYLYSKTQKTNRAIKTLLLDQHIIAGLGNIYVNE
VLFLSKVLPDKPAKLLSRSQVEDIINNSEQVLQKAIAMNGTTISDFESLPGVKGEYQNEL
LVHLRNNKKCKHCGSKILKTQVNNRGTYYCSVCQS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccagaagtcacaacagttgttaaagtgattaaaccaaaaatacttaat
aaaacaatacttggaattaatatttttacacctaagattgttaaatcagattcggttgat
aattttcaaaaaaaggttaaaaatcaaaaaattaataaagtttttaataaagcaaaatat
attgtacttgaacttgatgaacatgtaattatctctcatttaagaatgactggaaaatga
gtagttgagcaagctgaaacttatagttatgatcgatcatgactaagagccgaaattagt
ttagatgatcaaaagttttttagattttatgatgccagaggatttggaacattagatatt
tatgataaaaaagattatcagatagtttcaggattagatcaactaggcccaattccctta
aataaccaagtaagtgttgattatctttactcaaaaacccaaaaaactaatagggctatt
aagaccttattattggatcagcatatcattgcaggactgggtaatatttatgtcaatgag
gtattattcttatctaaagttctgcctgataaaccagctaaactattatctagatcacaa
gttgaagatattattaataattctgagcaagttttacaaaaagcaattgcaatgaatgga
acaactattagtgattttgaatcacttccaggagttaaaggagagtatcaaaatgaattg
ctggttcatttacgtaataacaaaaaatgtaaacattgtggttcaaaaattttaaaaaca
caggtaaataatagaggtacttattattgcagtgtttgtcaaagctaa

DBGET integrated database retrieval system