KEGG   Melissococcus plutonius DAT561: MPD5_0031Help
Entry
MPD5_0031         CDS       T01763                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17 6.1.1.24)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    MPD5_0031
Enzymes [BR:mpx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     MPD5_0031
Amino acid related enzymes [BR:mpx01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   MPD5_0031
Transfer RNA biogenesis [BR:mpx03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    MPD5_0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:44352..45812
Genome map
AA seq 486 aa AA seqDB search
MTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGDFIIRIEDTDQKRNIEGGEKSQLE
NLKWLGVDWDESPDNPGAYGPYRQSERKDIYQPLIDQLLSSNRAYKCYCTPEELKEEREG
QKAHGEMPHYAGKCANLTPSEQAENEAKGLIPVIRFRVPRNTSYTFNDMVKGEIVFESDN
IGGDFVIQKQDGMPTYNFAVAVDDHLMKITHVLRGDDHIANTPKQLMIYEAFGWTPPIFG
HMTLIINAATGKKLSKRDETILQFIEQYRELGYLPEAMLNFTTLLGWSPVGEEEIFSQRE
LIDMFDPKRLSKSPAAFDAKKLAWVNNQYVKKMDLHELTEMCIPYLIADGRVEKEPSSEK
IQWLENMVHLYQPQMSYAAEIVDLSALFFNEHPVLDDAAKEALSGETTPIVLSNFKDQLE
KLVIFDAPSIKAAIKTVQKETGIKGKPLFMPIRVAVSGQTHGPELAETIELLGKEKVLNH
LNNVLS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggttcgcgtacgctatgcaccaagtccaactgggcatttacatattggtaat
gcaagaacagcactatttaactatctatttgctcgccacaatgatggagattttattatt
cgaattgaggataccgaccaaaaaagaaatattgaaggcggtgaaaaaagtcagcttgaa
aacttaaaatggctaggtgttgattgggacgaatcacctgacaatccaggagcctacggc
ccttatcgtcaatctgagcgaaaagatatctaccaacctttaattgatcaacttttgagc
agtaatcgtgcttataaatgttattgtacgcctgaagaattaaaagaagaaagagaaggt
caaaaagcacatggtgaaatgccgcattatgctggtaaatgtgcgaatttaacaccaagt
gagcaagcagaaaatgaagctaagggattaattccagttattcgttttcgtgtccctaga
aatacttcttatacgtttaatgatatggttaagggagagattgtttttgagtctgacaat
atcggtggagattttgtcattcaaaagcaagatggtatgccaacttataattttgcggtt
gctgttgatgatcatcttatgaaaattacccatgttctacgtggagacgatcatattgct
aatacaccaaaacaattaatgatctatgaagcttttggttggacaccgcctatttttggc
catatgacattaatcattaatgccgcaactggtaaaaaattaagtaaacgtgatgaaaca
attttacaatttattgaacaatatcgcgaactaggttacctaccagaagcaatgttaaac
tttacaacattgttaggttggtcaccagtaggcgaagaagaaatcttttcacaaagagaa
ttaattgatatgtttgatccaaaacgtttaagtaaatcacctgctgcttttgatgcaaaa
aaattagcttgggtaaacaatcaatatgtgaaaaaaatggatttacatgaattaacagag
atgtgtataccatacttaatcgctgatggacgggtagaaaaagagccatcatcagagaag
atccaatggctggaaaatatggttcatctatatcaacctcaaatgagttatgctgcagaa
attgttgatttatctgcattatttttcaatgaacatcccgttcttgatgatgcagcaaaa
gaagcgttaagtggagaaaccacaccaatcgtcctatcgaactttaaagaccaattagaa
aaattagtaatttttgatgctcctagtataaaagcagcaattaagacagttcaaaaagaa
acaggaattaagggtaaaccacttttcatgcctatccgggttgctgtatcaggacaaaca
catggaccagaactagctgaaacgattgaattgttaggaaaagaaaaggttctaaatcat
ttaaataatgtgcttagctaa

DBGET integrated database retrieval system