KEGG   Melissococcus plutonius DAT561: MPD5_0086Help
Entry
MPD5_0086         CDS       T01763                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPD5_0086
  Lipid metabolism
   00071 Fatty acid degradation
    MPD5_0086
  Amino acid metabolism
   00350 Tyrosine metabolism
    MPD5_0086
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MPD5_0086
   00626 Naphthalene degradation
    MPD5_0086
Enzymes [BR:mpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MPD5_0086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:107639..108655
Genome map
AA seq 338 aa AA seqDB search
MKAAVVRQNPDGYADLVEKELRPIKENEALLDMEYCGVCHTDLHVAAGDYGNQAGTVLGH
EGIGIVREIGSDVTSLKVGDRVSVAWFFEGCGHCEYCVSGNETFCHEAKNAGYSVDGGMA
EQAIVTADYAVKVPDELDPVQASSLTCAGVTTYKAIKISGIKPGQWITIYGAGGLGNLAI
QFAKNVFNANVIVVDINDDKLNLAKKIGADMIINSLNENAPAIIQEKVGGASAAIVCAVA
RSAFEAAMNSLKPMGKMVAVALPNDKMEISIPQTVFYGIKVSGSLVGTRQDLAEAFQFGA
AGKVKPIVTTRRLEEINDIIDEMKAGNIEGRMVIDFTK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtagtacgtcaaaatccagatggatatgcagatttagttgaaaaagaa
cttcgtccgattaaagaaaatgaagcacttcttgatatggagtattgtggtgtttgtcat
acggatttacacgtagcagccggtgattatggaaatcaggcaggaacagttttaggacat
gaaggaattggtattgttagagaaattggtagcgatgtaacatctctgaaggtaggggac
cgggtatcggttgcatggttctttgaaggatgcggacattgtgaatattgtgtaagtggt
aatgaaacgttttgtcatgaagcaaaaaatgctggttatagtgttgatggtggtatggcg
gaacaagccattgttacagcggattatgcagtcaaagtaccagatgaattagatcctgtc
caagcaagttcactgacttgtgcaggtgtaactacctacaaggcaatcaaaattagtggc
attaaaccagggcaatggattaccatttatggagctggtggacttggaaatctagccatt
caatttgcaaaaaatgtttttaatgcaaatgttattgttgttgatatcaatgatgacaaa
ttaaatttagcaaaaaaaattggtgcagatatgatcattaattcacttaatgagaatgct
ccagcaatcattcaagaaaaagtaggtggggcttcggcagctattgtttgtgctgtggct
cgttcggcgtttgaagctgcaatgaacagtttgaaaccaatgggtaaaatggtcgctgtt
gctttaccaaatgataaaatggaaatctcaattcctcagacagtattttatggaatcaag
gtgagtggatcacttgtaggtacacgacaagacttagcagaagcattccaatttggtgca
gcagggaaggtcaaaccaattgtaacaactcgcagacttgaagagatcaatgatattatt
gatgaaatgaaagcaggtaatattgaaggtcgtatggttattgattttacaaaataa

DBGET integrated database retrieval system