KEGG   Melissococcus plutonius DAT561: MPD5_0185Help
Entry
MPD5_0185         CDS       T01763                                 

Definition
lacto-N-biosidase (EC:3.2.1.140)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MPD5_0185
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MPD5_0185
Enzymes [BR:mpx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MPD5_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:209993..211036
Genome map
AA seq 347 aa AA seqDB search
MKQLNQEKNDLPVQTERGVMIDIGRKFYTIEMLQALIDYMETLKMNVLQLHFSENEGFRL
ECQTMPELTSKEYLTKKDITSLIHYADVRNIMIIPEFDSPGHLKRLLTSHPEFQMSTFAH
NKGYLDDPLFDITNPQAVRLIKEIIQEYIELFSTTHYFHLGADEYLNFNELANYPLLQAN
AQKKYKNKELGYDLFIDYINELADKVEENGLIARVWNDGFYKTDELSKNKLKSTIQITYW
THYQKQMATVQTFIEKGHKILNFNDNFFYFVLGEEAGYKYPTGEKIKENWTINVFSGNQQ
LSKRDMRQVIGTYFAIWSDNSDALTETEVLTRIKEPLKEQQKKIWQY
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaattaaatcaagaaaaaaatgacttacctgtacaaacagaacggggggttatg
atagatatcggtagaaagttttatacgattgaaatgttgcaggcgttaattgattatatg
gaaactttaaaaatgaatgttctacaattacatttttcggagaatgaaggatttcgatta
gaatgtcaaactatgccagaattgacttcaaaggaatacctaacaaagaaagatattact
agcttaattcattatgctgatgttcgaaatattatgatcattcctgaatttgatagtcca
ggccatttaaaaaggttgctgacatcacatccagaattccaaatgagtacttttgctcac
aataaaggatatttagatgatccactatttgatattacaaatccacaggcagtaagatta
atcaaagaaattattcaggagtacattgaactgttttctactacgcattattttcatttg
ggtgcagatgaatatctgaattttaacgaattagcaaattatccactcctacaagcaaat
gctcaaaaaaaatataagaataaagaattaggttatgatttatttattgattatataaat
gaactagcagataaggtagaagaaaacggtttgatcgctagagtttggaatgatggtttt
tataaaacagatgaattatcaaaaaataaactaaaatcaacgatccaaattacctactgg
acacattatcaaaagcaaatggcgactgttcaaacgtttattgaaaaaggacataaaatt
ttgaattttaatgacaattttttctattttgttttgggagaagaagccggttataaatat
ccaactggcgagaaaatcaaagaaaactggacaataaatgtgttctcaggaaaccaacaa
ctttctaaaagagacatgcggcaagttataggcacctattttgcaatttggagtgacaat
tcagatgcattaaccgagacagaagtattaacacgtattaaagagcctttaaaagaacaa
caaaaaaagatttggcagtattaa

DBGET integrated database retrieval system