KEGG   Melissococcus plutonius DAT561: MPD5_0185Help
Entry
MPD5_0185         CDS       T01763                                 

Definition
lacto-N-biosidase (EC:3.2.1.140)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mpx00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:mpx00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:209993..211036
Genome map
AA seq 347 aa AA seqDB search
MKQLNQEKNDLPVQTERGVMIDIGRKFYTIEMLQALIDYMETLKMNVLQLHFSENEGFRL
ECQTMPELTSKEYLTKKDITSLIHYADVRNIMIIPEFDSPGHLKRLLTSHPEFQMSTFAH
NKGYLDDPLFDITNPQAVRLIKEIIQEYIELFSTTHYFHLGADEYLNFNELANYPLLQAN
AQKKYKNKELGYDLFIDYINELADKVEENGLIARVWNDGFYKTDELSKNKLKSTIQITYW
THYQKQMATVQTFIEKGHKILNFNDNFFYFVLGEEAGYKYPTGEKIKENWTINVFSGNQQ
LSKRDMRQVIGTYFAIWSDNSDALTETEVLTRIKEPLKEQQKKIWQY
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaattaaatcaagaaaaaaatgacttacctgtacaaacagaacggggggttatg
atagatatcggtagaaagttttatacgattgaaatgttgcaggcgttaattgattatatg
gaaactttaaaaatgaatgttctacaattacatttttcggagaatgaaggatttcgatta
gaatgtcaaactatgccagaattgacttcaaaggaatacctaacaaagaaagatattact
agcttaattcattatgctgatgttcgaaatattatgatcattcctgaatttgatagtcca
ggccatttaaaaaggttgctgacatcacatccagaattccaaatgagtacttttgctcac
aataaaggatatttagatgatccactatttgatattacaaatccacaggcagtaagatta
atcaaagaaattattcaggagtacattgaactgttttctactacgcattattttcatttg
ggtgcagatgaatatctgaattttaacgaattagcaaattatccactcctacaagcaaat
gctcaaaaaaaatataagaataaagaattaggttatgatttatttattgattatataaat
gaactagcagataaggtagaagaaaacggtttgatcgctagagtttggaatgatggtttt
tataaaacagatgaattatcaaaaaataaactaaaatcaacgatccaaattacctactgg
acacattatcaaaagcaaatggcgactgttcaaacgtttattgaaaaaggacataaaatt
ttgaattttaatgacaattttttctattttgttttgggagaagaagccggttataaatat
ccaactggcgagaaaatcaaagaaaactggacaataaatgtgttctcaggaaaccaacaa
ctttctaaaagagacatgcggcaagttataggcacctattttgcaatttggagtgacaat
tcagatgcattaaccgagacagaagtattaacacgtattaaagagcctttaaaagaacaa
caaaaaaagatttggcagtattaa

DBGET integrated database retrieval system