KEGG   Melissococcus plutonius DAT561: MPD5_0186Help
Entry
MPD5_0186         CDS       T01763                                 

Definition
pyruvate formate-lyase activating enzyme (EC:1.97.1.4)
Orthology
K04069  
pyruvate formate lyase activating enzyme [EC:1.97.1.4]
Organism
mpx  Melissococcus plutonius DAT561
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(211219..211995)
Genome map
AA seq 258 aa AA seqDB search
MNNKACIFNIQKFSIHDGPGIRTVVFFKGCPLNCQWCSNPESQNGSPEPMWDTKKHQYEL
IGNYQSLEEIIEEIIKDQPFYEESGGGVTLSGGEILYQSEFVIQLLKELQAKKIHTAGET
TGYAKPKIFADFIKHVDLLYFDVKHYDSKKHQQNIGVSNKQILKNLKIALENNTNLIIRI
PVIPNFNNSIDDAKNFAELFHLFGIKKVELLPFHQFGEEKYSHLNRNYLFKNIPQLHTEE
LNYFKEILESHQINCHVQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaaagcatgtatctttaatattcaaaaatttagcattcatgatggtccgggt
attcgaactgttgttttttttaagggttgtccgctaaattgtcaatggtgttctaatcca
gaatcacaaaatggttctccagaaccaatgtgggatactaaaaaacaccaatatgaacta
attggtaattatcaatcattagaagagattatagaagaaattataaaggatcaacctttt
tatgaagaatccggtggcggtgtgactctatccggtggagaaattttatatcagtctgaa
tttgttattcagctattaaaagaactacaagcaaagaaaattcatactgcgggcgaaaca
actggttatgcgaaacccaagatttttgcagattttattaaacatgttgaccttttatac
tttgacgttaaacactatgattctaagaaacaccaacaaaatatcggtgtatcaaataaa
caaattttaaaaaatttaaaaattgctttagaaaataacacaaatttaatcattcgaatt
cctgttattccaaacttcaataatagtatagatgatgcaaaaaactttgctgaattattt
catctatttggaataaaaaaagtagagcttttaccctttcatcaatttggtgaagaaaaa
tatagccatctaaatcgtaactacctatttaaaaatatacctcaattacacacagaagaa
ttaaattattttaaagaaattttggaatctcatcaaataaattgtcatgttcaataa

DBGET integrated database retrieval system