KEGG   Melissococcus plutonius DAT561: MPD5_0214Help
Entry
MPD5_0214         CDS       T01763                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MPD5_0214
   01230 Biosynthesis of amino acids
    MPD5_0214
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPD5_0214
  Energy metabolism
   00680 Methane metabolism
    MPD5_0214
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MPD5_0214
Enzymes [BR:mpx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MPD5_0214
Exosome [BR:mpx04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MPD5_0214
  Exosomal proteins of melanoma cells
   MPD5_0214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(248743..249429)
Genome map
AA seq 228 aa AA seqDB search
MPKLVFSRHGMSEWNALNQFTGWVDVNLSPEGIEEAKEGGRKIKEAGIDFDIAYTSVLTR
AIKTCNLILEYSDQLWVPQVKSWRLNERHYGKLQGLNKKETAEKYGDEQVHIWRRSYDTL
PPLLEEMDPGSALNDRRYAGLDKRDIPAGENLKVTLERALPFWQDHIAPSLVDDKTVLVA
AHGNSIRALVKHIEGISDDDIMGVEIPTGQPLVYELNTDLSVAKKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagttttttctcgtcatggaatgagcgaatggaatgcattaaatcaattt
accggttgggttgatgttaatttatcacctgaaggaattgaagaagcaaaagagggtgga
cgaaaaatcaaagaagctggaattgattttgatatcgcctatacttctgtcttaacacgt
gcaattaaaacgtgtaatttaattttagaatattctgaccaactatgggtacctcaagta
aaatcttggcgcttaaatgaacgtcattatggtaaattacaaggcttaaacaaaaaagaa
acagcagaaaaatatggagacgaacaagtacatatctggcgtcgttcttatgatacactg
cctccattattagaagaaatggatccaggttctgccttaaatgaccgtcgctatgctgga
ctggacaaacgtgatattccagctggagaaaatttaaaagttacattggaacgtgctcta
cctttctggcaagatcatattgctccttcattggtagatgacaagactgttttagttgcc
gcacatggtaattctatacgggctcttgttaaacatattgaaggtatttctgatgatgat
attatgggtgtagagattccaacaggtcaaccacttgtttatgaactaaacactgactta
tctgtagctaaaaaatactatctataa

DBGET integrated database retrieval system