KEGG   Melissococcus plutonius DAT561: MPD5_0220Help
Entry
MPD5_0220         CDS       T01763                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mpx00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:255505..256119
Genome map
AA seq 204 aa AA seqDB search
MSERGLLIVLSGPSGVGKGTVRKAIFDSENNDFQYSISMTTRKKRGGEVDGVDYHFRSRE
EFEAMIEAGEMLEYAEYVGNYYGTPLTYVNKTLDEGKDVFLEIEVQGAKQVREKVSDGIF
IFLTPPDLAELKSRIINRGTDDPEIIEERMRVAREEIEMMAVYDYAVVNDDVSVAVQKIK
NIIASEHFRVRHVIGKYIKMLKEI
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacgtggattattgattgtactatcaggtccatccggagttggaaaaggaaca
gtaagaaaagctatctttgatagtgagaacaatgattttcagtattctatttctatgact
actcgtaaaaagcgaggaggagaggtagatggcgtcgactatcattttcgttcacgtgag
gaatttgaggcgatgatcgaagcaggggaaatgttggaatacgctgaatatgtaggaaat
tattatggtacgccattaacttacgtaaacaagactttagatgagggaaaagatgtattt
ttagagattgaggtacagggtgcaaaacaagtcagagaaaaagtatctgatggtatcttt
atctttttaacaccacctgatttagcagaattaaaatcacgcattatcaatcggggaaca
gatgatcctgaaattattgaagagcgtatgcgggttgctcgtgaggaaatagaaatgatg
gctgtttatgattatgcagttgtgaatgatgatgtttcagtagctgttcaaaaaattaaa
aatattattgcaagtgaacattttcgtgttagacatgttattggaaagtatataaaaatg
ttaaaggagatttaa

DBGET integrated database retrieval system