KEGG   Melissococcus plutonius DAT561: MPD5_0446Help
Entry
MPD5_0446         CDS       T01763                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MPD5_0446
Enzymes [BR:mpx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MPD5_0446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:502951..505533
Genome map
AA seq 860 aa AA seqDB search
MDLLFDEEKAYIVGSVKAIFFENPTNFYKVLLIQLTETNTDFLEKEIVVTGSFGQIQEEE
LYRFYGHFVDHPRYGRQFQVDSYQKEKPTSMNGVINYLSSDKFPGIGRRTAEKIVEVIGK
DTIDQIIAHPETLKQVPNLNEKKRQVIIEGIQLNHGMEQIIVGLNQYGFGNQLSFTIYQV
YKEETLEVIKKNPYQLVEDIEGIGFKRADAIADQLGMTADATTRIQAAILHVLFQQSIQT
GNTYVKAEILLEETIELLEKSRPIEISHDQVAAQIIELVQKGKIQQETTELFNNSLYFAE
WGIGTSIQRLLAQKKETTYEAAKIKDSLRLLEKQLNISYGKIQQKAIKLAIKSPLFILTG
GPGTGKTTVINGIVSLFAELNGISLDLKDYTQKTFPILLAAPTGRAAKRMNEMTGLPAST
IHRLLGLTGREKNPGITAKELEGGLLIIDEMSMVDTWLANTLFKNIPTNMQVILVGDKDQ
IPSVGPGQVFYDLLQVDEIPKIELTKIYRQETDSSIIELAHEIKQGKLPENLTINQKDRS
FFRSDAFHIEHYIKQIISKATAKGFTAQDIQVLAPMYRGAAGINALNKMMQGIFNPADGK
KKEVTFGETTYRIGDKVLQLVNMPETNVFNGDMGEIVGIVPAKESDDKVDELVIQFDTNE
VSYKRNEWNKITLSYCCSIHKAQGSEFKMVILPMIHQYNRMLQRNLLYTAITRSKELLIL
LGEPEAFQQCVENEAATRLTRLKERIQRADTMTVSERLKLEAFEESLVNSSPFGEKQVTD
NKNDIEFTKNANKSANKLLTKETLTQPKSEVETISLFSEPSESKIQESKPHLLTMALIQA
NTIDPMIGMDGITPDQFVKN
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggatttgctttttgatgaggaaaaagcctacattgttggtagtgtcaaagccatcttt
tttgagaatcccaccaatttctataaagtattattgattcaactgacagagacgaataca
gattttcttgaaaaggaaattgtagtaacaggtagttttggtcaaattcaggaagaagaa
ctttatcgtttttatgggcattttgttgatcacccacgttacggacgacaatttcaagta
gatagttatcaaaaagaaaaaccaacatcgatgaatggtgtcattaattacctatcaagt
gataagtttcctggaattggtagacgaacagcagagaaaattgttgaagttatcggcaaa
gataccattgatcaaattattgctcatccggagactttaaagcaagttccaaatcttaat
gaaaaaaaacgtcaagtaattattgaaggaattcaattaaatcatggtatggaacaaatt
attgttggattgaatcaatatggatttggaaaccagctctcctttactatttatcaagta
tataaggaagaaacgctggaagttattaaaaaaaatccttatcagttagtagaagatatt
gaaggaattgggttcaagcgtgcagatgccattgcggatcaattgggaatgacggcagat
gcaacaacacgtattcaggcagcgatccttcatgtactttttcagcaatctatccaaacg
ggaaatacctatgtaaaagcagaaattttattagaagaaaccatcgaattattagagaaa
agtcgtccaatagaaatttcacatgatcaagtagcagcacaaatcattgagttagttcaa
aaaggaaaaatacagcaagaaacaaccgaattatttaataatagtctttattttgctgaa
tggggcattgggacttctattcagcgtttgttagctcaaaaaaaagaaacaacctatgaa
gcagccaaaataaaagattctctaagattacttgaaaagcaattaaatatctcttacgga
aaaatacagcaaaaggcgataaaactagcgattaaatctcccttatttatcctaactggt
ggaccaggtactggaaagacaaccgtcattaatggaattgtttcgctttttgcagaatta
aatggtatttctttagatttaaaagactatacacaaaagacatttccaattttgctggct
gcaccgactggcagggctgcaaaacgaatgaacgaaatgacaggattgcctgctagcacc
attcatcgtttactaggattaacaggtcgagaaaaaaatccaggaataacagcgaaagaa
ctagagggcggtttgttaatcattgatgaaatgtctatggtggatacttggttagccaat
acattatttaaaaatattcctactaatatgcaggtaatacttgttggtgataaggatcag
attccatccgtaggaccaggacaagttttttatgatctattgcaagtagatgaaatacct
aagattgaattaacaaaaatttatagacaagaaactgattcaagtattatcgaactagct
catgaaattaaacaaggtaaactaccagaaaacttaacgattaatcaaaaggatcgttcc
ttttttaggagtgatgcatttcatatcgaacattatataaagcaaatcattagtaaagca
acagcaaaaggttttacagcacaagatattcaggttcttgcaccaatgtatcggggagca
gctggcattaacgcacttaataaaatgatgcaaggtatttttaatccggcagatggcaaa
aagaaagaagttacgtttggagaaacaacctatcgtattggtgataaggtacttcagttg
gtaaatatgccagagacaaatgtttttaatggggatatgggtgagattgtcggcattgta
ccagcaaaagaatctgatgataaagtagatgaattggttattcaatttgacacgaatgaa
gtaagttataaacgaaatgaatggaacaaaattacattatcgtattgttgctccatccat
aaagcacaaggtagtgaatttaaaatggttatcctaccgatgattcaccaatacaatcgg
atgctacagcgcaatctgctttatacggctattactcgtagtaaggaattattaatttta
ttaggcgaaccagaagccttccagcagtgtgttgagaatgaggcagctactcgtttaact
cgtcttaaagaacgtattcaaagagcagataccatgacagtttctgaacgcttgaaatta
gaagcgtttgaagaaagcttagtgaattcctcaccatttggtgaaaaacaagttaccgat
aataaaaatgatatagaatttacaaaaaatgctaacaaatctgcaaataaactgctaacg
aaagaaacattgacccaaccaaaatctgaggttgaaactatttccttattttctgagcca
tcagaatcaaaaattcaagaatcaaaacctcatttactaactatggcattaattcaagca
aatacaattgatccaatgataggaatggatggaataactcctgatcaatttgtcaaaaat
tag

DBGET integrated database retrieval system