KEGG   Melissococcus plutonius DAT561: MPD5_0474Help
Entry
MPD5_0474         CDS       T01763                                 

Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
mpx  Melissococcus plutonius DAT561
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:536693..537448
Genome map
AA seq 251 aa AA seqDB search
MNRTKQLPKSLFTENGSRSVLLLHAYSGSSNDVRLLSRFLEKEGYTVYAPNFSGHGTLIP
EDILNRSPEDWRQETLDAIQFLYNKGYEQIAILGLSMGGLFAMDALTKNIDSLIGGGSFC
SPIYPCENHVPENFMLYAEQLLIKHNLSTSEIQYRLAEIKPRMLEQLKWLESFSKKITDQ
LSEITRPVFIAQSGCDQMIDRNSSFHTIKKLTQIPFTLQWYPDSGHVITTGPEHKKLEKD
VLHFLTTLSWN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagaacaaaacaattaccaaaatccctatttacagaaaatggatctagatcggtg
ttattattgcatgcctattctggtagcagcaatgatgttcgattgttgagtcgcttttta
gaaaaagaaggctatacagtgtacgcaccgaacttttctggacatggaacattgatacca
gaagatattcttaatagatcgccagaagattggcgacaagaaacattagacgccattcaa
tttctttataataaggggtatgagcagatagcaattttgggtctatcaatgggtggatta
tttgcaatggatgcattaaccaaaaatatcgatagtttaataggtggtggttctttttgt
tcccctatttatccttgtgaaaatcatgttccagagaactttatgttatatgcagaacag
ttattgataaaacataatttatcaaccagtgaaatacagtatcggttagcggaaataaag
cctcgcatgcttgaacagttaaaatggcttgaatcattttcaaaaaaaattacagatcaa
ttatcagaaattacacgaccggtttttattgcacaatctggttgtgatcaaatgattgat
aggaatagtagttttcacacaattaagaaattaacgcagatacctttcactttacaatgg
tatccagatagtggtcatgtcattactaccggccctgaacataaaaaactagaaaaagat
gttttgcattttttaacaacattatcttggaattga

DBGET integrated database retrieval system