KEGG   Melissococcus plutonius DAT561: MPD5_0474Help
Entry
MPD5_0474         CDS       T01763                                 

Definition
(GenBank) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
mpx  Melissococcus plutonius DAT561
Brite
Enzymes [BR:mpx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     MPD5_0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 DLH Peptidase_S9 Abhydrolase_1 BAAT_C PGAP1 Esterase Abhydrolase_3 DUF2048 Abhydrolase_2 SAM_2
Motif
Other DBs
NCBI-ProteinID: BAL61744
UniProt: H5T3K1
Position
1:536693..537448
Genome map
AA seq 251 aa AA seqDB search
MNRTKQLPKSLFTENGSRSVLLLHAYSGSSNDVRLLSRFLEKEGYTVYAPNFSGHGTLIP
EDILNRSPEDWRQETLDAIQFLYNKGYEQIAILGLSMGGLFAMDALTKNIDSLIGGGSFC
SPIYPCENHVPENFMLYAEQLLIKHNLSTSEIQYRLAEIKPRMLEQLKWLESFSKKITDQ
LSEITRPVFIAQSGCDQMIDRNSSFHTIKKLTQIPFTLQWYPDSGHVITTGPEHKKLEKD
VLHFLTTLSWN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagaacaaaacaattaccaaaatccctatttacagaaaatggatctagatcggtg
ttattattgcatgcctattctggtagcagcaatgatgttcgattgttgagtcgcttttta
gaaaaagaaggctatacagtgtacgcaccgaacttttctggacatggaacattgatacca
gaagatattcttaatagatcgccagaagattggcgacaagaaacattagacgccattcaa
tttctttataataaggggtatgagcagatagcaattttgggtctatcaatgggtggatta
tttgcaatggatgcattaaccaaaaatatcgatagtttaataggtggtggttctttttgt
tcccctatttatccttgtgaaaatcatgttccagagaactttatgttatatgcagaacag
ttattgataaaacataatttatcaaccagtgaaatacagtatcggttagcggaaataaag
cctcgcatgcttgaacagttaaaatggcttgaatcattttcaaaaaaaattacagatcaa
ttatcagaaattacacgaccggtttttattgcacaatctggttgtgatcaaatgattgat
aggaatagtagttttcacacaattaagaaattaacgcagatacctttcactttacaatgg
tatccagatagtggtcatgtcattactaccggccctgaacataaaaaactagaaaaagat
gttttgcattttttaacaacattatcttggaattga

DBGET integrated database retrieval system