KEGG   Melissococcus plutonius DAT561: MPD5_0498Help
Entry
MPD5_0498         CDS       T01763                                 

Definition
proposed amino acid ligase found clustered with an amidotransferase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mpx00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mpx00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(562617..563975)
Genome map
AA seq 452 aa AA seqDB search
MNVRSSLAVAAGKTSQWFLQTFLKGGSSYPGKLALKIDPKILDTLAKDYETIIVTGTNGK
TLTTALIVNILKQEFGDVLTNPTGANMEQGIVSTFLGAKKTHQQKKFAVLEIDEASLSHV
TKYIKPQTFVFTNIFRDQMDRYGEIYTTYRLILEGAKAAPEALIICNGDSPIFNSTDTMN
PRSYYGFNHLPDKDQAAHYNTDGLLCPKCQHILNYKMITYANLGKYYCSNCGFHRPQLDV
SLTAINQMDNHSSDFTIDGSTYHIPVGGMYNIYNALAATAVATHYHISAEKIRTGLKDND
EIFGRQETIQIGDKECTLILVKNPVGLNQVIDMIGLTPTSFSLVSLLNANYADGIDVSWI
WDGNQEAFATMNIPAVIAGGDRHQDMSLRLKVAGIPEEKIKEISSLDTVIDEIKKLPTKN
VYILATYTAVLQLRKLLTDKKYIQGGMSGAKK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtacgtagttccctcgctgttgccgctggtaaaacttcccaatggtttttacaa
acctttcttaagggtggaagtagttatcctggtaaattagcattaaaaatagatccaaaa
atcttggatactctagcaaaagactatgaaacaattattgtaacaggcaccaatggaaaa
acattgacaacggcattaattgtaaatattttaaaacaagaatttggtgatgttttaaca
aacccgacaggtgcaaatatggaacaagggattgtttcaactttccttggtgctaaaaaa
acacatcaacaaaaaaaatttgcagtattagaaatcgatgaagcaagcttaagtcatgtg
acaaaatatattaaaccacagacatttgtattcacaaacattttcagagatcaaatggat
cgctatggagaaatttatactacttatcgtttgattttagaaggtgcaaaggctgcacca
gaagcactaattatctgtaatggtgattcaccgatttttaattcaacagatacaatgaat
ccaagaagttattatggatttaaccatttaccagataaagatcaggctgcccattacaat
acagatggtttactatgtcctaaatgtcagcatattcttaattacaaaatgattacttac
gccaatcttggaaaatactattgttcaaattgtggttttcatcgtcctcagttagatgtt
tcattaacagctatcaatcagatggataatcattcttctgattttaccattgatggttca
acctatcatattccagtgggcggtatgtataatatttataatgctttggctgccacagcc
gttgcaacacattaccatatttcagctgagaaaattaggactggtttgaaagataatgat
gaaatctttggtaggcaggaaacaattcagattggcgataaagaatgtacattaatttta
gttaaaaatcctgtaggattgaatcaggtcattgatatgattggtttaacgccaacatct
ttctcactcgtctctttactaaatgcaaattatgctgatggtattgatgttagctggatt
tgggatggaaatcaggaagcatttgctacaatgaatattccagctgtcattgcaggtggt
gatcgtcatcaagatatgtctttacgtctaaaggtcgctggaattcctgaagaaaaaata
aaagaaatctcctcattagatacagtcattgatgaaattaaaaaattgccaacaaaaaat
gtttatattttagctacctatacagcagtgttacaattacgcaaattgcttacagataaa
aaatatattcaaggaggaatgagtggtgccaaaaaataa

DBGET integrated database retrieval system