KEGG   Melissococcus plutonius DAT561: MPD5_0617Help
Entry
MPD5_0617         CDS       T01763                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MPD5_0617
   01230 Biosynthesis of amino acids
    MPD5_0617
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPD5_0617
   00030 Pentose phosphate pathway
    MPD5_0617
   00051 Fructose and mannose metabolism
    MPD5_0617
   00052 Galactose metabolism
    MPD5_0617
  Energy metabolism
   00680 Methane metabolism
    MPD5_0617
Enzymes [BR:mpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MPD5_0617
Protein phosphatases and associated proteins [BR:mpx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MPD5_0617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:686269..687231
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVVRKGIYDKIEVYGINYGYAGLVAGDIRRLDVSDVGDK
IQRGGTFLYSARYPEFATEEGQLKGIEQLKKFGIEGLVVVGGDGSYQGALALTKRGFPAI
GIPGTIDNDIPGTDFTIGFDTAINTVLESIDRIRDTATSHVRTFVIEVMGRNAGDIALWS
GVAGGADEIVIPEHNFDMASVAKRIQEGRDRGKKHCLIILAEGVMGGHEFAEKLSDFGDF
HTRVSILGHMVRGGSPSARDRVLASKFGAYAVELLEQGRGGLCVGVVDNKMVSSDIIDTL
KNKHHDPDMSLYGLNQQISF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttaaccagcggtggcgatgcaccaggaatgaatgctgcaatt
cgggcagttgtccgaaaaggaatctatgacaaaatagaagtttacggaatcaattatggg
tatgcaggattagttgctggcgatattcgtcgtttagatgtttctgatgttggtgacaag
attcaacgaggaggcacctttttatactctgctcgttacccagaatttgcaactgaagaa
gggcaattaaaggggattgagcaattaaaaaaatttggtatcgaaggattggtcgttgta
ggcggtgatggttcctatcagggagcacttgctttgacaaaacgcgggtttccagcaatt
gggattccaggaacaatcgataacgatattccaggtacagattttacaattgggtttgat
acagctattaatacggttcttgaatcgattgatagaattcgcgatactgcaacttctcat
gtacgcacatttgttattgaggtgatgggaaggaatgcaggagacattgctttatggtct
ggtgttgctggcggtgcagacgaaattgttattcctgaacataactttgatatggcttct
gtagcaaaacgtattcaagaaggacgagatcgtggtaagaagcattgtttaattatccta
gcagaaggcgtaatgggcggacatgaatttgcagaaaaactttctgactttggtgatttt
cacacaagagtttccattttaggtcatatggttcgtggtggttctccaagtgctcgcgat
cgtgttctagccagcaaatttggtgcatatgcggttgagcttcttgaacaaggaagaggc
ggtctatgtgttggtgttgtcgacaataagatggtttcatcagacattattgatacactt
aaaaacaagcaccatgatccagatatgtccttatatggattaaatcagcaaatatctttt
taa

DBGET integrated database retrieval system