KEGG   Melissococcus plutonius DAT561: MPD5_0755Help
Entry
MPD5_0755         CDS       T01763                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPD5_0755
   00052 Galactose metabolism
    MPD5_0755
Enzymes [BR:mpx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     MPD5_0755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:825842..826882
Genome map
AA seq 346 aa AA seqDB search
MDIRVKDFGKEEKLYSLVNDNGIILEVTTFGARIVNLYVPVETEKRNIVFGFDSTEEYQE
KDTYIGSTIGRVAGRIRKGEFNIQDRWYQAAINTPEGNTLHGGPDSFETKSWTALTGQTK
DRVSVEFSLTSEDGENGFPGNLQISVTYTLNNNNEWIINYKATTDQPTLFNPTNHVYFNL
TGDPSQSVAEHQLMLEADQFAVVDQATLPTGEKRTVEGSPFDFRKVAPIKQAFESTNEQN
KLVDGLDHPFFLNKPGTKNAKAKLIAPDKRVAVEVFTDQSAIVIFTAQLPDKWLIHGKPL
IYHGGITFETQVCPGAEEFPEFGNIDLFPGEIYESRTCYRILTEDQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggatatcagggtaaaagattttggtaaagaagaaaaattgtattcacttgtaaatgat
aacggaatcattttagaagtaacaacctttggcgctcgaattgtcaatttgtatgttccc
gtagagaccgaaaaaagaaatattgtttttggatttgattctacagaagaatatcaagaa
aaagatacttatataggatcaacaattggtcgagtagctggacgaattagaaaaggcgag
tttaatattcaagatagatggtatcaggcggctataaatacaccagaaggtaatacttta
catggtggcccagatagttttgaaacaaaaagttggacggcattaacaggtcaaacgaaa
gatcgagttagtgtggaattttcgctaactagcgaggatggtgagaatggatttccaggg
aacttgcaaatctcagtaacctatacacttaataataataatgaatggattataaattat
aaagcaacaactgatcaaccaaccttatttaatccaacgaatcatgtgtattttaatcta
acaggtgatccaagtcaatcagttgcagaacatcagttaatgttagaggcagatcagttt
gctgtcgtcgatcaagcgaccttaccaacgggcgaaaaacgaacagttgaaggttcacca
tttgattttcgtaaagtagcaccaataaagcaggcttttgaatcaaccaatgaacaaaat
aaattggttgatggattggatcatccatttttcttaaacaaacctggaactaaaaatgct
aaagcaaaattaattgcacctgataaaagggtcgctgttgaagtatttacagatcaatcc
gccattgttattttcactgcccaattacctgataaatggctaatacatggtaaaccactt
atttatcatggaggaattacctttgaaacccaagtttgtccaggagcagaagaatttcca
gaatttggaaatatcgatttatttcctggagaaatttatgaaagtagaacatgttatcga
attttaacggaagatcaataa

DBGET integrated database retrieval system