KEGG   Melissococcus plutonius DAT561: MPD5_0792Help
Entry
MPD5_0792         CDS       T01763                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mpx00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mpx00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:864465..865391
Genome map
AA seq 308 aa AA seqDB search
MIITSERISLKHLLTIESLTDQEVIGLIQRAREFKQGRNWQPAKRPYFATNLFFENSTRT
HKSFEVAEKKLGLEVVDFEAQTSSVQKGETLYDTVLTMSAIGVDVAVIRHSQENYYEELI
QSKTIQCAIINGGDGSGQHPTQCLLDLMTIYEEFGSFSGLKIAIVGDIMHSRVAKSNMQM
LKRLGAEIYFSGPPEWYDKQFDAYGQYRLLDEIIEEIDVVMLLRVQHERHDGSELFSKET
YHREYGLTIERAKKLPKKAIIMHPAPVNRDVELADQLVEGLQSRIITQMSNGVYMRMAIL
EAILQGRA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
ttgattattacatctgagagaattagtttaaaacaccttttaaccattgaatcactcact
gaccaagaagtcattggcttaattcaacgggcaagagaatttaagcaaggaaggaattgg
caaccagccaagagaccttattttgctactaatcttttttttgaaaatagtacacgaaca
cataaaagctttgaagttgctgaaaaaaaacttgggttagaagtcgttgattttgaagcg
caaaccagttcggttcaaaaaggagaaacattatatgataccgtgttaaccatgtcagct
attggtgtagatgtagcagtaatacgacatagtcaagaaaattattatgaagaattaatt
caaagtaagacgattcaatgtgccattattaatggtggagatggaagtggccagcatcct
acacaatgcctattggatttaatgacgatttatgaagaatttggttctttttctggatta
aaaatagcgattgttggcgatattatgcattcacgtgtcgctaaatctaatatgcaaatg
ttaaaacgtctgggagcagaaatttacttttcaggtccaccagaatggtatgacaaacaa
tttgatgcttacggacaatatagactattagatgaaattattgaagagattgatgttgtt
atgcttttacgagttcagcatgaacgacatgacggttcagaattattttcaaaggaaact
tatcatagagaatatggcttaacaattgaacgtgcaaaaaaattgcctaaaaaagcaatt
attatgcatccagcacctgttaatcgagatgtagaattagcagaccaacttgtagagggc
ctacaatcaagaattattacacaaatgagcaatggcgtttatatgcgtatggctatttta
gaagcaattttacaaggaagggcataa

DBGET integrated database retrieval system