KEGG   Melissococcus plutonius DAT561: MPD5_1058Help
Entry
MPD5_1058         CDS       T01763                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MPD5_1058
   01230 Biosynthesis of amino acids
    MPD5_1058
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPD5_1058
   00051 Fructose and mannose metabolism
    MPD5_1058
   00562 Inositol phosphate metabolism
    MPD5_1058
Enzymes [BR:mpx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MPD5_1058
Exosome [BR:mpx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MPD5_1058
  Exosomal proteins of bladder cancer cells
   MPD5_1058
  Exosomal proteins of melanoma cells
   MPD5_1058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1177751..1178506)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTAASAKEFVEDVKTKIPANSKVDSVVGAPTLFLQELVEVAKGTDLK
ISAQNCFWENSGAYTGETSPAALSDLGINYVIIGHSERRDYFHETDEEINKKAKMIFSNG
MIPILCCGESLETYEDGRTVEWIEKQIKADLKSLTAGQVSSLVIAYEPIWAIGTGKSANP
EIADKICGVIRSTVEKLYDKETAESVRIQYGGSVKPENIADYMEKENVDGALVGGASLET
DSFLALLNAIK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaaaccaattatcgctggaaattggaaaatgaataaaacggctgcttctgcaaaa
gaatttgtagaagacgtaaaaacaaaaattcctgccaatagcaaggtagattctgttgtt
ggtgctcctaccttatttttacaagaacttgtagaagtagcaaaaggaacagatttgaaa
atctctgctcaaaattgtttctgggaaaattctggagcatatactggtgaaacatcacca
gctgcacttagtgatttaggtatcaattatgttattattggtcactcagaacgtcgtgat
tatttccatgaaactgatgaagaaatcaacaaaaaagcaaagatgattttctctaatggt
atgatcccaattctatgttgtggggaatccttagaaacctatgaagacggtagaactgta
gagtggattgaaaaacaaatcaaagctgatttaaagagtttaacagctggtcaggtctct
tcattagtcattgcttatgaaccaatttgggcaattggaactggcaaatcggctaatccg
gaaattgcagataagatttgtggtgtcattcgttcaaccgttgaaaaattatatgacaaa
gaaacagcagaaagtgtccgtatccaatatggtggttccgtgaaaccagaaaatattgca
gattacatggaaaaagaaaatgttgatggtgcattggttggtggagctagtctagaaact
gactcatttttggctctactcaatgcaatcaaataa

DBGET integrated database retrieval system