KEGG   Melissococcus plutonius DAT561: MPD5_1058Help
Entry
MPD5_1058         CDS       T01763                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
mpx00010  Glycolysis / Gluconeogenesis
mpx00051  Fructose and mannose metabolism
mpx00562  Inositol phosphate metabolism
mpx01100  Metabolic pathways
mpx01110  Biosynthesis of secondary metabolites
mpx01120  Microbial metabolism in diverse environments
mpx01130  Biosynthesis of antibiotics
mpx01200  Carbon metabolism
mpx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPD5_1058
   00051 Fructose and mannose metabolism
    MPD5_1058
   00562 Inositol phosphate metabolism
    MPD5_1058
Enzymes [BR:mpx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MPD5_1058
Exosome [BR:mpx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MPD5_1058
  Exosomal proteins of bladder cancer cells
   MPD5_1058
  Exosomal proteins of melanoma cells
   MPD5_1058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAL62283
UniProt: H5T540
Position
1:complement(1177751..1178506)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTAASAKEFVEDVKTKIPANSKVDSVVGAPTLFLQELVEVAKGTDLK
ISAQNCFWENSGAYTGETSPAALSDLGINYVIIGHSERRDYFHETDEEINKKAKMIFSNG
MIPILCCGESLETYEDGRTVEWIEKQIKADLKSLTAGQVSSLVIAYEPIWAIGTGKSANP
EIADKICGVIRSTVEKLYDKETAESVRIQYGGSVKPENIADYMEKENVDGALVGGASLET
DSFLALLNAIK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaaaccaattatcgctggaaattggaaaatgaataaaacggctgcttctgcaaaa
gaatttgtagaagacgtaaaaacaaaaattcctgccaatagcaaggtagattctgttgtt
ggtgctcctaccttatttttacaagaacttgtagaagtagcaaaaggaacagatttgaaa
atctctgctcaaaattgtttctgggaaaattctggagcatatactggtgaaacatcacca
gctgcacttagtgatttaggtatcaattatgttattattggtcactcagaacgtcgtgat
tatttccatgaaactgatgaagaaatcaacaaaaaagcaaagatgattttctctaatggt
atgatcccaattctatgttgtggggaatccttagaaacctatgaagacggtagaactgta
gagtggattgaaaaacaaatcaaagctgatttaaagagtttaacagctggtcaggtctct
tcattagtcattgcttatgaaccaatttgggcaattggaactggcaaatcggctaatccg
gaaattgcagataagatttgtggtgtcattcgttcaaccgttgaaaaattatatgacaaa
gaaacagcagaaagtgtccgtatccaatatggtggttccgtgaaaccagaaaatattgca
gattacatggaaaaagaaaatgttgatggtgcattggttggtggagctagtctagaaact
gactcatttttggctctactcaatgcaatcaaataa

DBGET integrated database retrieval system