KEGG   Melissococcus plutonius DAT561: MPD5_1237Help
Entry
MPD5_1237         CDS       T01763                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Glycolysis / Gluconeogenesis
Benzoate degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:mpx01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mpx00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mpx00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mpx00650]
Metabolism; Lipid metabolism; Fatty acid degradation
Metabolism; Amino acid metabolism; Tyrosine metabolism
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:mpx00362]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:mpx00625]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:mpx00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1378621..1381212)
Genome map
AA seq 863 aa AA seqDB search
MAQAKKEVGQEMDIQTMINELAGKANVALKEMANFDQEKVDHIVHQMAIAALDQHMQLAK
LAVEETGRGIVEDKAIKNIYASEYIWNSIKNNKTVGIINEDDQTGLIEIAEPVGVICGVT
PTTNPTSTTIFKSLIALKTRNPIIFAFHPSAQQCSKKAAMIVRDAAIQAGAPENCVQWIE
YPSIEATSALMNHSGIATVLATGGAGMVKSAYSTGKPALGVGPGNVPSYIEKTANIKRAV
NDLIISKSFDNGMICASEQAIIVDKEIYAAVKEEFEAHQVYFIKPNELSKLEDAVMNEEK
TAVNPVIVGNSAEVIANLAGIKVPKGTKILVAELEGVGAKYPLSREKLSPVLAMIKANNT
EQALDLCEAMLELGGLGHTAVIHTEDEGLQVNFGLRMKACRILVNSPSAEGGIGNIYNEM
IPSLTLGCGSYGKNSVSKNVSAINLINVKTIAKRRNNMQWIKLPRVYFEKNSLQYLQTME
NVERVMLVCDPGMVQFGYADIVVKELQKRANDIKLVTFSEVEPNPSTNTVYAGTKMMREF
EPDTIIALGGGSAMDAAKGMWMFYEHPDTSFFGAKQEFLDIRKRTYKIKKAVKSKLVCIP
TTSGTGAEVTPFAVITDSDTHVKYPLADYALTPDVAIVDPQFVLSVPASVTADTGMDVLT
HAIESYVSVMASDYTRGLSLQAIKLVIENLEKSVNTADMEAREKMHNASTMAGMAFANAF
LGITHSIAHKIGGEYNIPHGRTVGILLPHVIRYNATDPSKHAMFPKYDYFRADTDYADIA
KFIGLKGKDTAELVEALATTVYELGQKVGIKMNLKDQGVTKAVLDSTVDRMAELSYEDQC
TTANPKEPLISELKQIIINAYNG
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagcgaaaaaagaggtaggacaagaaatggatattcaaacaatgattaatgaa
ttggcaggcaaggcaaatgtggctttgaaagaaatggcaaatttcgatcaagaaaaagtt
gatcatattgttcatcaaatggcaatagctgcattggatcaacatatgcaattggcaaaa
ttggcagtagaagaaactggtcgaggtattgttgaagataaagcaattaaaaatatttat
gcttctgaatatatatggaatagtatcaaaaataataaaacggttggtattatcaatgaa
gatgaccaaactggtttaatcgaaatagcagaaccagtaggtgtcatttgtggtgttacg
ccaacaacgaatcctacatcaacgactatttttaaatctttaattgccttaaaaacacga
aatccaattatttttgcttttcatccaagtgcacaacaatgttcaaagaaagcagccatg
attgttagagatgcagcaattcaggcaggagcaccagaaaattgtgttcaatggattgaa
tacccatctattgaagctacttctgcattgatgaatcactcaggtatagctaccgtgttg
gctacagggggagctggtatggtaaaatctgcttattcaactggaaaaccagctttggga
gttggacctggaaatgtcccttcctatattgaaaaaacagcaaatattaagcgtgccgtt
aacgatttgattatttcaaaatcatttgataatggaatgatttgtgcttcagaacaagca
attattgtagataaagagatttacgcagctgttaaagaagaatttgaagcacaccaagtt
tattttattaaaccaaatgaattaagtaaactagaagatgctgtaatgaatgaagaaaaa
acagctgtaaatccagtaattgtaggtaattctgctgaggtaattgccaatttagcaggc
atcaaggtaccaaaaggaacaaaaattttagttgctgaattagaaggtgtaggagcgaaa
tatccattatcacgtgaaaaactatctcctgtccttgctatgataaaggcaaataataca
gaacaagcgcttgatttatgtgaagcaatgctagaattaggtggattaggacatacagca
gttattcatacagaagatgaaggattgcaagttaactttggtttacgaatgaaagcttgt
cgtatcctggttaattctccttcagcagaaggtggtataggaaatatttataatgaaatg
attccatctttaactttaggttgtggttcatatggaaagaattctgtttctaaaaatgtt
tctgctattaacctaattaacgttaaaacaattgcgaaacggagaaataatatgcaatgg
attaaattaccacgagtttactttgaaaaaaattctttacaatatttacaaacaatggaa
aatgttgaacgagtaatgctggtttgtgatcctggaatggttcaatttggatatgcagat
atagtagtaaaagaattgcaaaaacgtgctaacgatataaaacttgttactttttctgaa
gttgaaccaaatccatcaaccaatactgtttatgcgggtactaagatgatgagagaattt
gaaccagacacaattattgccttaggtggtggttcagcaatggatgctgcaaaaggtatg
tggatgttctatgaacacccagacacttcattctttggtgcaaaacaagaattcttagat
attcgtaaacgaacgtacaaaattaaaaaagccgtgaaatcaaagctcgtttgtattcct
acaacttccggaacaggggcagaagtaacgccatttgctgtaattactgatagtgataca
catgtaaaatacccattagcagattatgcattaacacctgatgtagctattgttgatcca
caatttgttttatctgtacccgcttctgtaactgcagataccggaatggatgtcctaact
catgccattgaatcttatgtttcagtcatggcttccgattacacacgtgggctcagtcta
caggcaattaaattagttatcgaaaatttagaaaaatccgtaaatacagcagatatggaa
gcacgtgaaaaaatgcataatgcttcaacaatggctggtatggcatttgcaaatgcattc
ttgggaattactcattctattgcacataaaattggtggagaatataatattccacatggt
cgtactgtaggtatattattgcctcatgtgattcgttataatgcaactgatccatcaaaa
catgcaatgtttcctaaatatgattactttagagcggatacagattatgctgatattgct
aaattcattggattaaaaggaaaggatactgctgagttggttgaagccctggcaacaacg
gtttatgaacttggtcaaaaagttggaatcaaaatgaacttaaaagatcaaggtgtcaca
aaagcagtacttgattctactgttgatcgaatggcagaattatcttatgaagatcaatgt
acaactgccaatccaaaagaaccattaattagtgaattaaaacaaattattattaatgcc
tataacggttaa

DBGET integrated database retrieval system