KEGG   Melissococcus plutonius DAT561: MPD5_1237Help
Entry
MPD5_1237         CDS       T01763                                 

Definition
(RefSeq) alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
  KO
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MPD5_1237
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPD5_1237
   00620 Pyruvate metabolism
    MPD5_1237
   00650 Butanoate metabolism
    MPD5_1237
  Lipid metabolism
   00071 Fatty acid degradation
    MPD5_1237
  Amino acid metabolism
   00350 Tyrosine metabolism
    MPD5_1237
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MPD5_1237
   00626 Naphthalene degradation
    MPD5_1237
Enzymes [BR:mpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MPD5_1237
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MPD5_1237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1378621..1381212)
Genome map
AA seq 863 aa AA seqDB search
MAQAKKEVGQEMDIQTMINELAGKANVALKEMANFDQEKVDHIVHQMAIAALDQHMQLAK
LAVEETGRGIVEDKAIKNIYASEYIWNSIKNNKTVGIINEDDQTGLIEIAEPVGVICGVT
PTTNPTSTTIFKSLIALKTRNPIIFAFHPSAQQCSKKAAMIVRDAAIQAGAPENCVQWIE
YPSIEATSALMNHSGIATVLATGGAGMVKSAYSTGKPALGVGPGNVPSYIEKTANIKRAV
NDLIISKSFDNGMICASEQAIIVDKEIYAAVKEEFEAHQVYFIKPNELSKLEDAVMNEEK
TAVNPVIVGNSAEVIANLAGIKVPKGTKILVAELEGVGAKYPLSREKLSPVLAMIKANNT
EQALDLCEAMLELGGLGHTAVIHTEDEGLQVNFGLRMKACRILVNSPSAEGGIGNIYNEM
IPSLTLGCGSYGKNSVSKNVSAINLINVKTIAKRRNNMQWIKLPRVYFEKNSLQYLQTME
NVERVMLVCDPGMVQFGYADIVVKELQKRANDIKLVTFSEVEPNPSTNTVYAGTKMMREF
EPDTIIALGGGSAMDAAKGMWMFYEHPDTSFFGAKQEFLDIRKRTYKIKKAVKSKLVCIP
TTSGTGAEVTPFAVITDSDTHVKYPLADYALTPDVAIVDPQFVLSVPASVTADTGMDVLT
HAIESYVSVMASDYTRGLSLQAIKLVIENLEKSVNTADMEAREKMHNASTMAGMAFANAF
LGITHSIAHKIGGEYNIPHGRTVGILLPHVIRYNATDPSKHAMFPKYDYFRADTDYADIA
KFIGLKGKDTAELVEALATTVYELGQKVGIKMNLKDQGVTKAVLDSTVDRMAELSYEDQC
TTANPKEPLISELKQIIINAYNG
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagcgaaaaaagaggtaggacaagaaatggatattcaaacaatgattaatgaa
ttggcaggcaaggcaaatgtggctttgaaagaaatggcaaatttcgatcaagaaaaagtt
gatcatattgttcatcaaatggcaatagctgcattggatcaacatatgcaattggcaaaa
ttggcagtagaagaaactggtcgaggtattgttgaagataaagcaattaaaaatatttat
gcttctgaatatatatggaatagtatcaaaaataataaaacggttggtattatcaatgaa
gatgaccaaactggtttaatcgaaatagcagaaccagtaggtgtcatttgtggtgttacg
ccaacaacgaatcctacatcaacgactatttttaaatctttaattgccttaaaaacacga
aatccaattatttttgcttttcatccaagtgcacaacaatgttcaaagaaagcagccatg
attgttagagatgcagcaattcaggcaggagcaccagaaaattgtgttcaatggattgaa
tacccatctattgaagctacttctgcattgatgaatcactcaggtatagctaccgtgttg
gctacagggggagctggtatggtaaaatctgcttattcaactggaaaaccagctttggga
gttggacctggaaatgtcccttcctatattgaaaaaacagcaaatattaagcgtgccgtt
aacgatttgattatttcaaaatcatttgataatggaatgatttgtgcttcagaacaagca
attattgtagataaagagatttacgcagctgttaaagaagaatttgaagcacaccaagtt
tattttattaaaccaaatgaattaagtaaactagaagatgctgtaatgaatgaagaaaaa
acagctgtaaatccagtaattgtaggtaattctgctgaggtaattgccaatttagcaggc
atcaaggtaccaaaaggaacaaaaattttagttgctgaattagaaggtgtaggagcgaaa
tatccattatcacgtgaaaaactatctcctgtccttgctatgataaaggcaaataataca
gaacaagcgcttgatttatgtgaagcaatgctagaattaggtggattaggacatacagca
gttattcatacagaagatgaaggattgcaagttaactttggtttacgaatgaaagcttgt
cgtatcctggttaattctccttcagcagaaggtggtataggaaatatttataatgaaatg
attccatctttaactttaggttgtggttcatatggaaagaattctgtttctaaaaatgtt
tctgctattaacctaattaacgttaaaacaattgcgaaacggagaaataatatgcaatgg
attaaattaccacgagtttactttgaaaaaaattctttacaatatttacaaacaatggaa
aatgttgaacgagtaatgctggtttgtgatcctggaatggttcaatttggatatgcagat
atagtagtaaaagaattgcaaaaacgtgctaacgatataaaacttgttactttttctgaa
gttgaaccaaatccatcaaccaatactgtttatgcgggtactaagatgatgagagaattt
gaaccagacacaattattgccttaggtggtggttcagcaatggatgctgcaaaaggtatg
tggatgttctatgaacacccagacacttcattctttggtgcaaaacaagaattcttagat
attcgtaaacgaacgtacaaaattaaaaaagccgtgaaatcaaagctcgtttgtattcct
acaacttccggaacaggggcagaagtaacgccatttgctgtaattactgatagtgataca
catgtaaaatacccattagcagattatgcattaacacctgatgtagctattgttgatcca
caatttgttttatctgtacccgcttctgtaactgcagataccggaatggatgtcctaact
catgccattgaatcttatgtttcagtcatggcttccgattacacacgtgggctcagtcta
caggcaattaaattagttatcgaaaatttagaaaaatccgtaaatacagcagatatggaa
gcacgtgaaaaaatgcataatgcttcaacaatggctggtatggcatttgcaaatgcattc
ttgggaattactcattctattgcacataaaattggtggagaatataatattccacatggt
cgtactgtaggtatattattgcctcatgtgattcgttataatgcaactgatccatcaaaa
catgcaatgtttcctaaatatgattactttagagcggatacagattatgctgatattgct
aaattcattggattaaaaggaaaggatactgctgagttggttgaagccctggcaacaacg
gtttatgaacttggtcaaaaagttggaatcaaaatgaacttaaaagatcaaggtgtcaca
aaagcagtacttgattctactgttgatcgaatggcagaattatcttatgaagatcaatgt
acaactgccaatccaaaagaaccattaattagtgaattaaaacaaattattattaatgcc
tataacggttaa

DBGET integrated database retrieval system