KEGG   Melissococcus plutonius DAT561: MPD5_1309Help
Entry
MPD5_1309         CDS       T01763                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mpx03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1466585..1467181)
Genome map
AA seq 198 aa AA seqDB search
MYYPQPIAKLIESYMKLPGIGQKTAIRLAFYTIDMDEEDVTNFAKSLISVKRDLHFCSNC
GNITEEDLCDICQDKTRDHSTILVIEEPKDITAMEKMREYHGLYHVLNGVLSPMEGTGPE
DINIASLIQRLHNDEIKEVILATNATTEGEATAMYLSRLIKPAGIKVTRLAHGLSVGSDI
EYADEITLLKAIEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtattatccacaacctattgctaaattaattgaaagttatatgaaactgccgggaatt
ggacagaaaacagcgattcggcttgccttttatacaattgatatggatgaagaagatgtt
actaattttgcaaaatctttaatcagtgtcaaaagggatcttcatttttgtagtaattgt
ggaaatattactgaagaggatctttgtgatatttgtcaagataaaacaagagatcatagt
accattttagtaatagaggaacctaaagatattacagcgatggagaagatgcgtgaatat
catggcctttatcatgtacttaatggtgttctttcaccgatggaaggtacaggtcctgaa
gatataaatattgcctctttgattcaacgactgcataatgatgaaataaaagaagttatt
ttagcaacaaatgcaacgactgagggggaagcaactgctatgtatctttcaagattgatt
aaaccagctggtattaaagtaacccgtctagcacatggattatctgtaggtagtgatatt
gaatatgcagatgaaataacacttttaaaagcgattgagggaagaagagaattgtaa

DBGET integrated database retrieval system