KEGG   Melissococcus plutonius DAT561: MPD5_1318Help
Entry
MPD5_1318         CDS       T01763                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
mpx00010  Glycolysis / Gluconeogenesis
mpx00052  Galactose metabolism
mpx00500  Starch and sucrose metabolism
mpx00520  Amino sugar and nucleotide sugar metabolism
mpx00521  Streptomycin biosynthesis
mpx01100  Metabolic pathways
mpx01110  Biosynthesis of secondary metabolites
mpx01120  Microbial metabolism in diverse environments
mpx01130  Biosynthesis of antibiotics
mpx01200  Carbon metabolism
Module
mpx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPD5_1318
   00052 Galactose metabolism
    MPD5_1318
   00500 Starch and sucrose metabolism
    MPD5_1318
   00520 Amino sugar and nucleotide sugar metabolism
    MPD5_1318
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MPD5_1318
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MPD5_1318
Enzymes [BR:mpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MPD5_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: BAL62532
UniProt: H5T5T9
Position
1:complement(1475502..1476476)
Genome map
AA seq 324 aa AA seqDB search
MMDKKLIGIDLGGTTIKFAILTVDGIIQQKWSVQTNILDEGTHIIDDIVASINHRLALYH
MQPEEFIGIGMGTPGSVDIEKGTVIGAYNLNWNTLQFVKKQVEEETGISFMLDNDANVAA
LGEDWMGAGKNSKDVVFITLGTGVGGGIIAQGQLIHGTKGCAGEIGHVTVDPNGFKCTCG
KRGCLETVSSATGIVRVARQLSEEYVGNSSLKKAIDEGQAVTSKDVFNYAELENDPLALK
VVDRVCYFLGLALGNIGNTLNPNSIIIGGGVSAAGEFLRSRIQTYFDRFTFPQVRESTKL
KLAQLGNEAGVIGAASLALNYLEN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgatggataagaaattaattggtattgacctaggtggaactacaatcaaatttgctatt
ttaactgtagatggcattattcaacaaaaatggagtgttcaaacgaatattttagatgag
ggtacccatattattgatgacattgtcgcttcaattaatcatcgactcgctctttatcac
atgcaaccagaagagtttattggaattggcatgggaacaccaggaagtgtcgatattgaa
aaagggacagtcattggtgcatataatttaaattggaacaccttacaatttgtaaagaag
caagtagaagaagaaacaggcatttcttttatgttagacaacgatgcaaatgttgctgct
ctaggtgaagattggatgggagcaggtaaaaatagtaaggatgttgtctttatcacatta
ggcacaggtgtgggcggtggcattatcgcacaaggacaattaattcatggaacaaagggt
tgtgctggtgagattggacatgttacggttgatcctaatggattcaaatgtacctgtgga
aaaagagggtgtcttgaaacagtatcaagtgctactggtattgttcgagtagctagacaa
ctatcagaagaatatgttggtaattcttctttaaagaaagccattgatgaagggcaggca
gttacaagtaaagatgtatttaattatgcagaattagaaaatgatccattggcattaaaa
gtagtagatcgtgtttgttattttttgggacttgctttaggaaatattggcaatacatta
aatccaaatagcattatcataggtggtggtgtctctgcagccggtgaattcttgagaagt
cgtattcaaacatattttgatcgttttactttcccacaagttagagaaagtactaaactc
aagttagcacaattaggaaatgaagccggtgttattggtgcagcctcattagcattaaat
tatttggaaaattag

DBGET integrated database retrieval system