KEGG   Melissococcus plutonius DAT561: MPD5_1432Help
Entry
MPD5_1432         CDS       T01763                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MPD5_1432
   00500 Starch and sucrose metabolism
    MPD5_1432
Enzymes [BR:mpx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     MPD5_1432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1592011..1592928)
Genome map
AA seq 305 aa AA seqDB search
MAKIYERTPIKKFSVGKGKLYDFTTIQAAIDEATNWDEKIQILIFPGDYQENVRIYGEDI
ELIGIGEVVITSNLAAYQINYQGEERGTFQTATVFINGQTILLKNLSIVNTAGPGEIVGQ
AVALYIEGTDIHIDSCKLDGYQDTLCLGPLPKFQKDGKQLMVSPWLKIPYTEQIVDFHYC
QISGTVDFIFGGGQASFYHCQLYVKKNTHTNYITAASTPKNQKGFYFVSCMVTGDSPYYL
GRPWRQYAAVTFVNSYFDQQLYSTGWHDWDKPKNRQTVNYQEINCLYLGEKSSTRWATKE
MSEQK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagatttatgaaagaacacctataaaaaaattttcagttggaaagggcaagtta
tatgattttactacaattcaagccgctattgatgaagcaacaaactgggatgagaaaata
cagattctaatttttcctggcgactatcaagaaaatgtaagaatctatggtgaagatatt
gaattaattggcattggtgaagtggttattactagtaatttagctgcttatcaaataaat
tatcaaggtgaggagagaggtacatttcagacagccaccgtttttatcaatggccaaacg
attttattaaagaatttatcgatcgttaatactgctggacctggtgaaattgttggccaa
gctgtagctctttatattgaaggaacagatatccatattgattcttgtaaacttgatggc
tatcaagataccttatgcttaggaccacttcctaagtttcagaaggacggaaaacagcta
atggttagtccatggctaaagatcccttatactgaacagatcgttgattttcactattgc
cagattagtggaactgttgattttatttttggtggtggtcaagctagtttttatcattgt
caactgtatgtaaaaaagaatacgcatacaaattatattacagctgcatctactccgaaa
aatcaaaaaggattttattttgtttcatgcatggtaactggtgattctccctattattta
ggtagaccttggcgtcaatatgcagctgttacttttgttaatagttattttgatcaacaa
ctatattcaacggggtggcatgattgggataaaccaaaaaatcgacaaacagtgaactat
caagaaatcaattgcctttatctaggtgaaaaatcatcgactcgatgggcaacgaaagaa
atgagtgaacaaaaatga

DBGET integrated database retrieval system