KEGG   Melissococcus plutonius DAT561: MPD5_1457Help
Entry
MPD5_1457         CDS       T01763                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MPD5_1457
  Lipid metabolism
   00561 Glycerolipid metabolism
    MPD5_1457
   00600 Sphingolipid metabolism
    MPD5_1457
Enzymes [BR:mpx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     MPD5_1457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1625529..1626485)
Genome map
AA seq 318 aa AA seqDB search
MISGLWLEIEVMGIHCPLADKLPDDWFFTRHGKRVIDIDRYHLDFRNKEVIAYADQVLDR
LITDYGIGYIKMDYNITTGIGTDYLSDSYGEGLLAHNRAYLNWLDHLFQRYPDLVIENCG
SGGMRHDYAMLSRHSLQSLTDQTDYLRNGAIAAVGASAVTPEQCAVWSYPLEDGDEEEVI
YNMINSLLLRVHQSGYLNKLSDNRFKLVTEGLNVYKQIRQQILKSLPIWPTGLAKLDDSK
YTFGLIGDRQLLLAVWNNKQKENLIEVDLTKYGKVETVTQIYPKAPEYQTTIFNVNNQVA
FKFETAPSARLYKITLEK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatttctggattatggctagaaattgaagtcatggggatccattgtccattggcagat
aaattaccagatgattggttttttactcgtcatggaaaacgtgttattgacatcgatcgg
taccacttagattttcgtaataaagaagtaatcgcttatgcggatcaggtattggatcgt
ttaattaccgattatggaattggttatataaaaatggactataacattaccacaggtata
ggcaccgattatttatcagatagctatggtgaaggactactcgctcataatcgtgcgtat
ctaaattggttagatcacttgtttcaacgatatccagatcttgtaattgaaaattgtggg
agtggtggtatgcgtcatgattatgccatgctttctagacatagccttcaatccttgacc
gatcagacggactacctacgcaatggcgctattgcagctgttggtgcatctgcagtaaca
ccggaacaatgtgctgtttggtcctatcctttagaggatggcgatgaagaagaagtaatc
tataatatgataaattcattactacttagagttcatcaaagtgggtatttaaataaattg
tcagataatcgttttaagttggtaactgaaggattaaacgtatataaacaaattcgtcag
caaattttaaaatcattaccaatttggccgacaggattagcaaaattggatgattcaaaa
tatacttttggtctaataggggatcgtcaacttttattagctgtatggaataataaacaa
aaggaaaatttgattgaagtagatttaacaaagtatggaaaggttgaaacagttacccaa
atctaccctaaggcacctgaatatcaaacaacgatttttaatgttaataatcaagtcgcc
tttaaatttgaaactgctccaagtgctcgtttgtataaaatcactttagaaaaataa

DBGET integrated database retrieval system