KEGG   Melissococcus plutonius DAT561: MPD5_1458Help
Entry
MPD5_1458         CDS       T01763                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mpx00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mpx00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1626482..1627672)
Genome map
AA seq 396 aa AA seqDB search
MNEKNNPNIQMIEGKKSEIIFMITEAQQVCLLYMGELQRIDENWVKQAQKQTTAFLLTQV
QLTGDNIHHKGIKLSYSGTTDRLHYQEYYVEEKDFGKQVVIVEKDEKTGLIIHSFFQLFN
DSCTIRTFKIAENTGDEAVGIEWLSSLTLAGILQINDFPNNYAEHLEFSVAHNAWTAELQ
WETRTLKEYGINFYVDGEHKQPSSQRINITNNSSWSCSEFSPSGVLFNRFTNQSAGWQIE
HNGAWHYEIGDTGVGNLLYLTLFGPEEYDNHCWIQLKPHATFETVKTAYVQVSGDQEKVL
DELTIYRRLIRRVSKDNQQLPIIFNDYMNCLMGEPTTEVELPLIDAAARAGCEYFVIDCG
WYADGYWWDSVGEWLPSEKRFTNGINEVIRAIHKKE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaaaataatcccaatattcagatgattgaagggaaaaagtcagaaattatt
tttatgattacagaagcacaacaggtttgtcttctttatatgggagaattacaaaggata
gatgaaaattgggtaaagcaggctcaaaaacagacaactgcttttctacttacacaagtt
caattaacaggtgataatattcaccataaaggaatcaaactatcttatagtggaacaacg
gatcgtttacactatcaagaatattacgttgaagaaaaagattttggaaagcaagtagtc
attgtagaaaaagatgaaaaaactggactaattattcatagcttctttcaactatttaat
gatagttgtacaatacgtacatttaagatagctgaaaatacaggagatgaagctgtaggc
attgaatggttatcttcgctaacattggcaggtatcttacaaataaatgattttcctaat
aattatgctgaacatttggaattttcagtggctcataatgcttggacagctgaactacaa
tgggagacaagaacattgaaagaatatggtattaatttttatgtagatggcgaacataaa
caaccttcttcacaacgaattaatattacaaataattcttcttggtcctgttcggaattc
tcacctagtggcgtattgttcaatcgttttacgaatcaaagtgcaggatggcaaattgaa
cataatggtgcgtggcattatgaaattggagatacaggagtaggcaatttactttattta
actctttttggtccagaagaatatgacaatcattgttggattcaattaaaaccacacgct
acctttgaaactgttaaaacagcttacgttcaagtaagtggcgatcaagaaaaagttctt
gatgaattgactatttatagacgtctgattcggcgagtgtctaaagataatcaacaatta
ccaattatttttaatgattatatgaattgtttgatgggagaaccaacaacagaagtcgaa
ttacctttaattgatgcagcagctagagctgggtgtgaatattttgtcatagattgtggt
tggtatgcagatggatattggtgggatagtgttggagaatggctgccttctgagaaaaga
tttactaacgggatcaatgaagttataagagccattcataaaaaggaatga

DBGET integrated database retrieval system