KEGG   Melissococcus plutonius DAT561: MPD5_1472Help
Entry
MPD5_1472         CDS       T01763                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MPD5_1472
Enzymes [BR:mpx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MPD5_1472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1643046..1644746
Genome map
AA seq 566 aa AA seqDB search
MKKFIICLLFVGLFSLMGILNSSSAEAQESSSIDYVQKMGKGWNLGNSFDGFDLNNQHAY
EEAWGNPRVTREFLKKIKQQGFTSIRLPFSVINRQNTAGKIDPEFLARYKQVVDWAIAEG
FYVMVNLHHDSWQWLAKWNGDKNQSEYLRYVTIWQQLANEFKDESGKVSFESINEPTFEG
SKEQANEKLKTINQAFYQTVRDSGGKNATRYLILPTLYCDANPEAMNLLYQSILAFNDPY
LIATVHYYSEWVYSNSLGIMGFDDLLWDTTTSRKSADRLFQQMNEQLINRGIGVVIGEYG
LLGYDRSEEANDPGETYKYIEYMNKKASENKVCLMLWDNGQHFDRLKNTWKKPFFGDIVT
KSIDERSAYATGYQHTFIKQQTQQIDIPITWNHHKLKNIQYNGELLKEGSDYSSTTVGIT
LLPHFVAQQKQGAFERKGTLTLVFDGGANWLQQIYYSKQSELFDAKGDLGQTFTIPVKYN
GQRFKNGSLKNANGQIISSNPWWNYLINYQEFSPNYQKNNLTLSSDLTKLMQEGMTYTLT
IQTYQGESYTYQIRVVNGQLIGKNFK
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttattatttgtttattgtttgttggactgtttagcttaatgggaatacta
aacagtagctctgctgaagcacaagagtcttcttctatcgattatgttcaaaagatggga
aaaggttggaatttaggcaattcgtttgatggatttgatctgaataatcagcatgcttat
gaagaagcttggggaaatccacgagtcacgcgtgagtttttgaaaaaaattaagcaacaa
ggatttactagtattcggttacccttttctgtgattaatcgtcaaaatacagcaggaaaa
atcgatccagaatttctagctcgttataaacaagtcgttgattgggcaattgctgaaggt
ttctatgttatggttaatttacatcacgattcttggcagtggcttgcaaaatggaatggg
gataaaaaccaatctgagtatttacgttatgtgactatttggcagcaacttgctaatgaa
tttaaagatgaatcaggaaaagtcagttttgaatccatcaatgaaccaacgtttgaggga
agtaaagaacaggcaaatgaaaaattgaaaacgattaaccaagctttttatcaaacagta
agagactctggtggtaaaaatgcaactcgttatttaattttgcctaccttatactgtgat
gcgaatccagaagcaatgaatcttttataccagtctatcttagcattcaatgatccctat
ctcattgcaaccgttcattattatagtgagtgggtttatagtaatagtttaggcattatg
gggtttgatgatcttttatgggacacgacaacatcaaggaaaagtgctgatcggctattt
cagcaaatgaatgaacaactaatcaatcgaggtattggcgtagttattggtgagtatggc
ttattaggttatgatcgatcagaagaagcgaacgatccgggtgaaacttataaatatatt
gaatatatgaataaaaaagccagtgagaataaagtatgcttaatgttgtgggataatgga
caacattttgatcgcttaaaaaatacttggaaaaaacctttctttggtgatattgtaaca
aaatcaatcgatgaacgctctgcttatgccactggttatcaacatacctttatcaagcaa
cagacacaacaaattgatattccaataacttggaatcatcacaaacttaaaaacatccaa
tataatggggaattattaaaagaaggtagcgactattcaagtacaacagttggtattacc
ttacttcctcactttgttgcccaacaaaaacagggtgcttttgagagaaaaggcacattg
accttggtttttgatggtggtgcgaactggttacaacagatttattatagcaagcagtct
gaattattcgatgcaaaaggcgatctaggtcaaacgttcactattccagtaaagtataat
ggacaacgatttaaaaacggttctttaaaaaatgccaatggtcaaatcatctcaagtaat
ccttggtggaattacctgatcaattaccaagaattttcaccgaattatcaaaaaaataac
ctaactttatcaagtgacctcacaaagttaatgcaagaaggaatgacctatacattaacc
attcaaacctatcaaggcgaatcttatacctatcaaattagagtagtcaatggacaacta
attggtaaaaacttcaaataa

DBGET integrated database retrieval system