KEGG   Melissococcus plutonius DAT561: MPD5_1487Help
Entry
MPD5_1487         CDS       T01763                                 

Definition
beta-galactosidase 3
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mpx00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1662622..1664415)
Genome map
AA seq 597 aa AA seqDB search
MQRFEIKDEFLLNGQPFKILSGAIHYFRLHPDDWYHSLYNLKALGFNTVETYIPWNLHES
QEGNFHFDQQLDIEQFLKVAQSLDLYAILRPSPYICAEWEFGGLPAWLLNKNCRIRSSDP
KYLAYVSTYYQQILPRLAKHQLSENGNVLMFQVENEYGSYGEDKEYLTALKKLMKENGIT
APLFTSDGPWQATLRAGSLIDEDILVTGNFGSNAQKNFTEMKKFFKTHGKKWPLMCMEFW
DGWFNRWDEPIVKRETKELVEAFRETIELGSINLYMFHGGTNFGFMNGCSARGNTDLPQI
TSYDYGAPLNEQGNPTDKYYALQETVREVCPVLASSQKMPLIKPTIEIKDIPLKNKVSLF
ATITKLTTPLQTKYPVTMEAMNQTTGYIIYRTILPRDAKTETLRIIDGSDRAQTYLNGQH
IVTQYQAEIGENILVEPTKEQNQLDILIENMGRVNYGAKLTANTQKKGIRTGVMADLHFI
NDWEQFSLPLDTIESVDFSGEWVKNQPSFYQYEVDLTEIEDTFIDLANFGKGVVFVNNHH
LGRFWEIGPTLSLYIPKGFLHIGKNKIVIFETEGKYDSKIDLLNQPKFKSKKRGNKK
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
ttgcagagatttgagataaaagatgaatttttacttaatgggcaaccgtttaaaatttta
tctggtgcgattcactattttagattgcatccagatgactggtatcattctctctataat
ttaaaagcattaggttttaatacagtggaaacctatattccttggaacttacacgaatca
caagagggaaatttccattttgatcagcagttagacattgaacaatttttaaaagtagca
caatcactagatttatacgccattctaaggccttcaccttatatttgtgctgaatgggaa
tttggtggactacctgcttggttattgaataaaaattgccgaattcgttcctctgatcca
aaatatctcgcttacgtgtctacctattatcagcaaatattaccgagattagcgaaacat
caactaagtgaaaatggaaatgtgttaatgtttcaggttgagaacgaatacggctcatat
ggggaagataaagaatatttaactgcattaaaaaaattgatgaaagaaaatggcataacg
gcaccactttttacttcggatggtccatggcaggcgacacttagagcaggtagtttgatt
gatgaagatattttggtaacaggaaactttgggtcaaatgctcaaaaaaattttactgaa
atgaaaaagttttttaagacacatgggaaaaaatggccgctgatgtgtatggaattttgg
gatggttggtttaatcgttgggatgaaccaatcgttaaaagagaaaccaaggaattagtg
gaagcttttcgtgagacgattgaacttggtagtatcaatctttatatgtttcatggtggt
accaattttggttttatgaatggctgttcagctcgaggaaatacagacctaccacagatt
acttcctatgattatggtgctcctttaaacgagcaaggaaatccaaccgataaatactat
gccttgcaagaaacagtgagagaagtctgtccagtattagcttcttcacaaaaaatgcca
ttaatcaaaccgacaatcgaaattaaagatattcctttaaaaaataaggtcagtcttttt
gcaacaataaccaaattaactacaccattacaaacaaaatatccagtaacaatggaagcg
atgaatcagacgactggttatatcatttaccgaaccattctgccaagggatgcaaaaacg
gaaaccctacgaattattgatggaagtgatcgagcacaaacctatttaaatggccaacat
attgtgacgcaataccaagcagaaattggggaaaatattttagttgaaccaacaaaagaa
caaaaccagctagatattttaatagaaaatatgggacgcgtcaactatggtgcgaaatta
acagcaaatacacagaaaaaagggatccgaacgggcgttatggcagacttacattttatt
aatgattgggaacaattttctttacctttagatacgattgaatcagtcgatttttctggt
gaatgggtaaaaaatcaacctagcttttaccaatatgaagttgatttaaccgaaattgaa
gatacttttattgatttagcaaactttggtaagggtgtagtttttgtaaataatcatcac
ctaggtcgtttctgggaaattggccctactttatccttatatattcctaaaggctttttg
catattgggaaaaataaaattgttattttcgaaacagaagggaaatatgattcaaaaatc
gatttattgaatcaaccaaaatttaaatcaaagaagagaggaaacaaaaaatga

DBGET integrated database retrieval system