KEGG   Melissococcus plutonius DAT561: MPD5_1487Help
Entry
MPD5_1487         CDS       T01763                                 

Definition
beta-galactosidase 3
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MPD5_1487
Enzymes [BR:mpx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     MPD5_1487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1662622..1664415)
Genome map
AA seq 597 aa AA seqDB search
MQRFEIKDEFLLNGQPFKILSGAIHYFRLHPDDWYHSLYNLKALGFNTVETYIPWNLHES
QEGNFHFDQQLDIEQFLKVAQSLDLYAILRPSPYICAEWEFGGLPAWLLNKNCRIRSSDP
KYLAYVSTYYQQILPRLAKHQLSENGNVLMFQVENEYGSYGEDKEYLTALKKLMKENGIT
APLFTSDGPWQATLRAGSLIDEDILVTGNFGSNAQKNFTEMKKFFKTHGKKWPLMCMEFW
DGWFNRWDEPIVKRETKELVEAFRETIELGSINLYMFHGGTNFGFMNGCSARGNTDLPQI
TSYDYGAPLNEQGNPTDKYYALQETVREVCPVLASSQKMPLIKPTIEIKDIPLKNKVSLF
ATITKLTTPLQTKYPVTMEAMNQTTGYIIYRTILPRDAKTETLRIIDGSDRAQTYLNGQH
IVTQYQAEIGENILVEPTKEQNQLDILIENMGRVNYGAKLTANTQKKGIRTGVMADLHFI
NDWEQFSLPLDTIESVDFSGEWVKNQPSFYQYEVDLTEIEDTFIDLANFGKGVVFVNNHH
LGRFWEIGPTLSLYIPKGFLHIGKNKIVIFETEGKYDSKIDLLNQPKFKSKKRGNKK
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
ttgcagagatttgagataaaagatgaatttttacttaatgggcaaccgtttaaaatttta
tctggtgcgattcactattttagattgcatccagatgactggtatcattctctctataat
ttaaaagcattaggttttaatacagtggaaacctatattccttggaacttacacgaatca
caagagggaaatttccattttgatcagcagttagacattgaacaatttttaaaagtagca
caatcactagatttatacgccattctaaggccttcaccttatatttgtgctgaatgggaa
tttggtggactacctgcttggttattgaataaaaattgccgaattcgttcctctgatcca
aaatatctcgcttacgtgtctacctattatcagcaaatattaccgagattagcgaaacat
caactaagtgaaaatggaaatgtgttaatgtttcaggttgagaacgaatacggctcatat
ggggaagataaagaatatttaactgcattaaaaaaattgatgaaagaaaatggcataacg
gcaccactttttacttcggatggtccatggcaggcgacacttagagcaggtagtttgatt
gatgaagatattttggtaacaggaaactttgggtcaaatgctcaaaaaaattttactgaa
atgaaaaagttttttaagacacatgggaaaaaatggccgctgatgtgtatggaattttgg
gatggttggtttaatcgttgggatgaaccaatcgttaaaagagaaaccaaggaattagtg
gaagcttttcgtgagacgattgaacttggtagtatcaatctttatatgtttcatggtggt
accaattttggttttatgaatggctgttcagctcgaggaaatacagacctaccacagatt
acttcctatgattatggtgctcctttaaacgagcaaggaaatccaaccgataaatactat
gccttgcaagaaacagtgagagaagtctgtccagtattagcttcttcacaaaaaatgcca
ttaatcaaaccgacaatcgaaattaaagatattcctttaaaaaataaggtcagtcttttt
gcaacaataaccaaattaactacaccattacaaacaaaatatccagtaacaatggaagcg
atgaatcagacgactggttatatcatttaccgaaccattctgccaagggatgcaaaaacg
gaaaccctacgaattattgatggaagtgatcgagcacaaacctatttaaatggccaacat
attgtgacgcaataccaagcagaaattggggaaaatattttagttgaaccaacaaaagaa
caaaaccagctagatattttaatagaaaatatgggacgcgtcaactatggtgcgaaatta
acagcaaatacacagaaaaaagggatccgaacgggcgttatggcagacttacattttatt
aatgattgggaacaattttctttacctttagatacgattgaatcagtcgatttttctggt
gaatgggtaaaaaatcaacctagcttttaccaatatgaagttgatttaaccgaaattgaa
gatacttttattgatttagcaaactttggtaagggtgtagtttttgtaaataatcatcac
ctaggtcgtttctgggaaattggccctactttatccttatatattcctaaaggctttttg
catattgggaaaaataaaattgttattttcgaaacagaagggaaatatgattcaaaaatc
gatttattgaatcaaccaaaatttaaatcaaagaagagaggaaacaaaaaatga

DBGET integrated database retrieval system