KEGG   Melissococcus plutonius DAT561: MPD5_1550Help
Entry
MPD5_1550         CDS       T01763                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MPD5_1550
Enzymes [BR:mpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MPD5_1550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1740935..1741858)
Genome map
AA seq 307 aa AA seqDB search
MNKVTILGSSNIDLVISTKSLPQVGETILGDQLDYFYGGKGQNQAISSVRIGANVQLIGA
VGTDSFGEKILANLKTEGISTENIRQVEGAFTGLAMVLKLPQDNSIIVAPGANELVNPDY
LTNFTKKIITSDVLLVQMEIPFETVLASIKIAKRNQVITIVNPAPYSERCHELLEFTDVL
TPNKTEFEYLYGEKLTNEAMLEEAMLHFVKGYAVSLVVTRGSRGVSFVENNKVVTFSSIP
VEVIDTTGAGDTFNGILSTYLSRQCSLKEAVKCASIGASLSITKLGAQTGMPTTKELEQA
IKKYTMN
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggtaactattttaggtagtagtaatatcgatttagtaatttcaactaaaagt
cttccacaggttggagaaacgattttgggagatcaactagactatttttatggtggaaaa
ggccaaaaccaagctatttctagtgtgagaataggtgccaatgttcaattaatcggagct
gtaggaacagattcttttggagaaaaaattctagcaaatttaaaaacggaagggatatcg
actgaaaacattaggcaggtagaaggagcatttaccggactagcaatggttttaaaatta
cctcaagataattctattattgtagcacctggtgcaaatgaacttgttaatccagattat
ttaactaactttacaaaaaaaataattacaagtgatgtcttgttggtacaaatggaaatt
ccttttgaaactgtattagcgagtattaaaatagcgaaacgaaatcaagtcattacaatt
gtaaatccagctccctatagcgaaagatgtcatgaattgctagaatttactgatgtttta
acaccaaataaaacagaatttgaatatttatatggtgaaaaattaacgaatgaagcgatg
cttgaagaggcaatgctgcattttgtgaaaggatatgctgtttctttagttgttactcga
ggaagtcggggagttagctttgtggaaaataataaggtcgttactttttcttccattcca
gttgaggttattgatacaacaggtgctggtgatacatttaatggtattttatccacctat
ttatctcgacagtgttcattaaaagaagccgtcaagtgtgcttcaatcggtgcttcatta
tctataacaaaattaggagctcaaacaggtatgccaacaacaaaagaattagaacaagcc
attaaaaaatatactatgaactaa

DBGET integrated database retrieval system