KEGG   Melissococcus plutonius DAT561: MPD5_1696Help
Entry
MPD5_1696         CDS       T01763                                 

Definition
beta-hexosamidase A (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MPD5_1696
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MPD5_1696
Enzymes [BR:mpx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MPD5_1696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p1:complement(64350..66053)
Genome map
AA seq 567 aa AA seqDB search
MVDLTKKPYCLNKQQINYIEEKIAKMSIDEKVGQLFFVIGQDENMTDIAEFIEKYQPGGM
MYRPDVAEKIKREIATAQTASQVPLFFAANLESGGNGIISEGTWFGMPLQMAATDDPKSA
YELGNVSGFEASQVGCNMSFAPIVDIDKNFRNPITNTRTFGSDKTRVMKMAEAQIKGLEK
NQVIPVIKHFPGDGVDERDQHLVSSVNSLTKDDWMNTYGQIYRQLIETGISSIMIGHIMQ
PAWERYLQPDISDKDLRPASSSSLLINGLLRDVLQFNGLAITDATPMIGYNAATDRENLL
PETINAGIDMILFNKNIDEDYHYIRQAVENGKLPIERVNEAIMRILGTKLAQGIMDTNES
LLLTPPETLALDTKAHEKLAEEVAKKAVTLVKDRDHLLPLTPERYPRIRLVILGDSDEGG
FKEGGKVTDLFKMQLEKVGFIVSLYNSQQLDFHEIFEEGVQDMKEKFDLALYIANIETAS
NQTTTRLDWIPLMAANAPWFMQAIPTVFISTANPYHLFDIPSVSTFINAYTGNKASVEAV
MRKITGQEAFEGINPVDPFCGDFTAKL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggtagatttaacaaaaaaaccttattgcttaaataaacaacaaattaattatattgaa
gaaaaaattgctaaaatgtcaattgatgaaaaggttggtcaattattttttgtcattggt
caagatgaaaatatgacggatattgctgaattcatagaaaaataccaacctggtggtatg
atgtatcgtccagacgtggctgaaaaaatcaagcgtgaaatagcaacagctcaaacagct
agtcaggttcctcttttctttgcagcaaatctagaatctggtggtaatggcattatatct
gaaggcacttggtttggtatgcctcttcaaatggctgcaactgatgatccaaaaagtgct
tacgaattaggtaatgtttctggttttgaagccagtcaagtcggttgtaatatgtctttt
gccccaattgttgatattgataaaaattttagaaatcctattacaaacacacgaacattt
ggtagtgataaaacacgagtaatgaaaatggcagaagctcaaatcaaagggttagaaaaa
aatcaagttatcccagttatcaaacactttcctggagatggtgtggatgagagagatcag
catttagtaagttctgtaaattcattaactaaagatgactggatgaatacttatggacaa
atctatcgtcaacttattgaaacaggtatttctagtattatgattggccatatcatgcaa
cctgcctgggaacgttatttacaacctgatatttccgataaagatttacgaccagcttcc
agttcttctcttttaattaatggattgttgcgagatgttctgcaattcaacggactagcg
attacagacgcaaccccaatgattggttacaatgcagcaacagatcgtgaaaacttactg
ccagaaacaatcaatgcaggaattgatatgattctttttaataaaaacattgatgaagat
tatcactatatcagacaagccgttgaaaatggtaaattgccaatagagcgtgtcaatgaa
gcaattatgcgaattcttggtacaaaattagcgcaaggcatcatggatacaaacgaaagt
ttactgcttacaccaccggaaacattagcattagataccaaagcacatgaaaaattggcg
gaagaagtcgcaaaaaaagctgtgacattggtgaaagatcgtgatcacttgcttccacta
actcctgaaagatacccacgtatccgactagttattttaggagactctgatgagggtgga
tttaaagaaggcggaaaagtcacagatctgtttaaaatgcagttagaaaaagttggcttt
attgtttctctttataattctcaacagttagacttccatgaaatttttgaagaaggcgtt
caagatatgaaggaaaaattcgacttagcgctttatattgcaaatattgaaacagccagc
aatcaaacaactacaagactggattggattcctctaatggcagctaatgcaccatggttt
atgcaggcgattcctaccgtgtttatctcaacagcaaatccttatcatttatttgacatt
ccaagtgtttcaacatttattaatgcctatacaggaaacaaagcgagtgttgaagctgtt
atgcgaaaaattactggacaggaagcctttgaaggaatcaatccagtagatcccttctgt
ggtgatttcacagcaaaattataa

DBGET integrated database retrieval system