KEGG   Melissococcus plutonius DAT561: MPD5_1704Help
Entry
MPD5_1704         CDS       T01763                                 

Definition
beta-glucosidase (EC:3.2.1.21 3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPD5_1704
Enzymes [BR:mpx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     MPD5_1704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p1:73635..75035
Genome map
AA seq 466 aa AA seqDB search
MSIISKVPTDFPENFLWGASTSAFQVEGAAFEDGKGISVADLRAKKSKFLDTSVTVDHYH
HLEEDVRLMKELGLKSYRFSISWTRIYPNGNDLKPNEKGLAFYHKLINLLVENQIEPIVT
IFHFDLPQQLVEQYNGWADRRCVDDYVCYAKLLFEEFGSQVNYWLTINEHSLLVNVPSMI
GLHSDNMKELRQLAENANYYMFLAQAKVFNLCHAMLPKAMIGPAVSYMTNLPYQHKSTDA
LLGKSLEDVVSFLTMDVAVRGEFPSYYLRKLQEEGLKLPYLPEDEAVFATGRADFLGLNW
YCTSIFRENEQASSKMLKGVIDHIERYEDPDLQHTDWGFSYDPVGLRYALQRVHDRFPNL
PLMITECGWSERENLEKGQVHDTTRVNFLRDHIAQLREAIRDGVNVLSFNPWSFIDLLSV
GDGMDKRYGLIYVDRDNHSAKDLKRYKKDSFYFYQKTIQQNAKNIQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagtataatttcaaaagtaccaacagattttccagaaaattttttatggggagccagt
acttctgcttttcaagtagaaggagcagcctttgaagatggtaaaggaatttcagttgct
gatttacgagcaaagaaaagtaaatttttagatacttctgtgaccgttgatcattatcat
catcttgaggaagatgttcggttgatgaaagaattgggtttaaaatcttatcgtttttct
attagctggacacgaatttatccaaacggcaatgatttaaaacctaatgaaaaaggattg
gctttttatcataaacttattaatttgttagtagaaaatcaaattgaaccaattgtgacg
atttttcattttgatttacctcaacaattagttgaacaatataatggttgggcagatcga
agatgtgtcgatgattatgtttgttatgctaaactattatttgaagaatttggaagtcag
gtaaactattggttaacgattaatgaacattcacttttggtaaatgttcccagtatgatt
ggcttacatagtgataatatgaaagagttaagacaattggcagaaaatgcaaattattat
atgtttttagcacaagctaaagtcttcaatttatgtcatgctatgttgccaaaagcaatg
attgggccggctgtctcttatatgacaaatttaccttatcagcataaatcaacagatgct
ttgctaggcaaatcgttagaagatgtagttagtttcttaacgatggatgtagcggttcga
ggagaatttccttcttattatttaagaaaattacaagaagagggactaaaacttccctat
ttaccagaagatgaagctgtctttgcaactggacgtgccgactttttaggattgaattgg
tattgtacaagtatttttagggaaaatgaacaagcatcatcaaaaatgttaaagggcgtt
attgatcatattgagcgttatgaagatccagatttacagcacacagattggggattttct
tatgacccggttggattaagatatgctttacagcgagtacatgatcgctttccaaattta
ccattaatgataacagaatgtggttggtcagaaagagagaatttggaaaaaggtcaggta
catgataccacccgggtaaattttttaagagatcatattgcacaactaagagaagccatt
cgggatggtgtaaatgttctttcttttaatccatggtcctttattgatttattaagtgta
ggagatgggatggataaacgttatggacttatttatgtcgatcgtgataatcactcagca
aaagacttgaagcgttataaaaaagatagcttttatttctatcagaaaacgattcaacaa
aatgcaaaaaatattcagtaa

DBGET integrated database retrieval system