KEGG   Methanolobus psychrophilus: Mpsy_0058Help
Entry
Mpsy_0058         CDS       T02280                                 

Definition
AMP-binding protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mpy  Methanolobus psychrophilus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpsy_0058
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpsy_0058
   00620 Pyruvate metabolism
    Mpsy_0058
   00640 Propanoate metabolism
    Mpsy_0058
  Energy metabolism
   00680 Methane metabolism
    Mpsy_0058
Enzymes [BR:mpy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mpsy_0058
Lipid biosynthesis proteins [BR:mpy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mpsy_0058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
54984..56654
Genome map
AA seq 556 aa AA seqDB search
MSSLLEKYVSRSEFDSYEDFKENFSIKIPDNFNFAYDVVDVYAREQPDKKALIWCDDNGE
EKGFSFADLANYSNKTANILKRYGIRKGDSVMLMLKSRYEFWFFLLALHRIGAIAVPATH
MLTKKDIVYRVERAGIKMIVAAPDKGILDCVDDACNEISNILKTRIAIGLQRDDWTSFEK
ELETASADFTRPTGEEATINEDILLNYFSSGTTGFPKMVQHNFTYPLAHIITARYWQNVT
DGGLHYTVADSGWAKCVWGKIYGQWIAGSAVFVYDYDRFTAERMLENTVKYGVTTFCAPP
TIYRFLIREDLSKYDLGCLDYCVTAGEPLNPEVYQKFLEITGLKLMEGFGQTETIVTLAT
YPWVEPKPGSMGKPSPEYSIELLNAEGKPCEVGEEGEIVIDTSFGKPPGIFIGYGADPEK
TKDVWHDGYYHTGDMAWKDEDGYFWFVGRADDIIKTSGYRVGPFEVESALIEHPAVLECA
ITGVPDPVRGQVIKATIVLTRDYTTSEELKKELQDHVKRVTAPYKYPRVVEFVKELPKTI
SGKIRRVEIRDHDKQK
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcactactggaaaaatacgtctcgcgcagcgaattcgattcatacgaggatttc
aaggagaacttcagcatcaaaattcctgataacttcaatttcgcatacgatgtggtcgat
gtttacgcaagggaacagccagataaaaaagcccttatctggtgcgatgacaatggagaa
gaaaaaggattctctttcgcggacctcgccaactacagcaataaaacagccaatattctc
aaacgatatggcatcagaaaaggcgacagtgtaatgctcatgctcaaaagcaggtatgag
ttctggttcttcctgctggctctgcacaggatcggtgccatagctgttcctgcgacccat
atgctaactaagaaggatattgtttacagggtggagcgcgccgggatcaaaatgatagtg
gctgctccggacaaagggatactggattgtgtggacgatgcctgcaatgagatcagcaat
atcctcaaaaccaggattgcaattggcctgcaaagagatgactggacctcatttgagaag
gaactggaaacggcctctgctgactttacacgcccgactggtgaagaggctactattaat
gaggacatattgctgaactatttctcctcaggaactacaggcttccccaagatggtgcag
cataatttcacatatcctcttgcacatataataactgccagatactggcagaatgtgaca
gacggcggcctgcactacactgtagcagattcaggatgggcaaagtgcgtatggggtaag
atatatggtcagtggatagcaggaagtgcggtctttgtatacgattatgacaggttcact
gccgagaggatgctggagaacacagtaaagtatggtgtgacgacattctgtgcaccgcct
accatctaccgcttccttatcagggaggaccttagcaaatatgatctgggctgcctggat
tactgcgtgactgcaggagagccgctaaatcccgaggtttaccagaagttcctggaaata
acgggccttaaactcatggaagggttcggacagacagagaccatcgtcaccctcgcaact
tatccctgggtcgagccaaaacccggttccatgggtaagccatcccctgagtactccatt
gaactgcttaacgccgaaggcaaaccgtgtgaggttggtgaggaaggagaaatcgtgatc
gacaccagttttgggaagcctcctggaatattcatcggttacggagctgaccctgagaag
acaaaggatgtctggcacgacggttattaccacacaggggacatggcatggaaggatgag
gacggctatttctggttcgtgggaagggctgacgacatcatcaagacctcagggtacagg
gtaggaccttttgaagttgagagtgcccttattgagcaccctgcagtactcgaatgtgct
attacaggcgtccctgacccggtaagaggacaggtcatcaaggcaaccattgtgctcacg
agggactatacgacaagcgaggaactgaaaaaagaactccaggaccatgttaagagagtc
actgctccgtacaagtacccccgtgtggtcgagtttgtgaaagaactgccaaagactata
agcggcaagatcagacgtgtggagatacgcgaccacgacaaacaaaagtaa

DBGET integrated database retrieval system