KEGG   Methanolobus psychrophilus: Mpsy_0058Help
Entry
Mpsy_0058         CDS       T02280                                 

Definition
AMP-binding protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mpy  Methanolobus psychrophilus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpsy_0058
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpsy_0058
   00620 Pyruvate metabolism
    Mpsy_0058
   00640 Propanoate metabolism
    Mpsy_0058
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpsy_0058
   00680 Methane metabolism
    Mpsy_0058
Enzymes [BR:mpy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mpsy_0058
Lipid biosynthesis proteins [BR:mpy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mpsy_0058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
54984..56654
Genome map
AA seq 556 aa AA seqDB search
MSSLLEKYVSRSEFDSYEDFKENFSIKIPDNFNFAYDVVDVYAREQPDKKALIWCDDNGE
EKGFSFADLANYSNKTANILKRYGIRKGDSVMLMLKSRYEFWFFLLALHRIGAIAVPATH
MLTKKDIVYRVERAGIKMIVAAPDKGILDCVDDACNEISNILKTRIAIGLQRDDWTSFEK
ELETASADFTRPTGEEATINEDILLNYFSSGTTGFPKMVQHNFTYPLAHIITARYWQNVT
DGGLHYTVADSGWAKCVWGKIYGQWIAGSAVFVYDYDRFTAERMLENTVKYGVTTFCAPP
TIYRFLIREDLSKYDLGCLDYCVTAGEPLNPEVYQKFLEITGLKLMEGFGQTETIVTLAT
YPWVEPKPGSMGKPSPEYSIELLNAEGKPCEVGEEGEIVIDTSFGKPPGIFIGYGADPEK
TKDVWHDGYYHTGDMAWKDEDGYFWFVGRADDIIKTSGYRVGPFEVESALIEHPAVLECA
ITGVPDPVRGQVIKATIVLTRDYTTSEELKKELQDHVKRVTAPYKYPRVVEFVKELPKTI
SGKIRRVEIRDHDKQK
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcactactggaaaaatacgtctcgcgcagcgaattcgattcatacgaggatttc
aaggagaacttcagcatcaaaattcctgataacttcaatttcgcatacgatgtggtcgat
gtttacgcaagggaacagccagataaaaaagcccttatctggtgcgatgacaatggagaa
gaaaaaggattctctttcgcggacctcgccaactacagcaataaaacagccaatattctc
aaacgatatggcatcagaaaaggcgacagtgtaatgctcatgctcaaaagcaggtatgag
ttctggttcttcctgctggctctgcacaggatcggtgccatagctgttcctgcgacccat
atgctaactaagaaggatattgtttacagggtggagcgcgccgggatcaaaatgatagtg
gctgctccggacaaagggatactggattgtgtggacgatgcctgcaatgagatcagcaat
atcctcaaaaccaggattgcaattggcctgcaaagagatgactggacctcatttgagaag
gaactggaaacggcctctgctgactttacacgcccgactggtgaagaggctactattaat
gaggacatattgctgaactatttctcctcaggaactacaggcttccccaagatggtgcag
cataatttcacatatcctcttgcacatataataactgccagatactggcagaatgtgaca
gacggcggcctgcactacactgtagcagattcaggatgggcaaagtgcgtatggggtaag
atatatggtcagtggatagcaggaagtgcggtctttgtatacgattatgacaggttcact
gccgagaggatgctggagaacacagtaaagtatggtgtgacgacattctgtgcaccgcct
accatctaccgcttccttatcagggaggaccttagcaaatatgatctgggctgcctggat
tactgcgtgactgcaggagagccgctaaatcccgaggtttaccagaagttcctggaaata
acgggccttaaactcatggaagggttcggacagacagagaccatcgtcaccctcgcaact
tatccctgggtcgagccaaaacccggttccatgggtaagccatcccctgagtactccatt
gaactgcttaacgccgaaggcaaaccgtgtgaggttggtgaggaaggagaaatcgtgatc
gacaccagttttgggaagcctcctggaatattcatcggttacggagctgaccctgagaag
acaaaggatgtctggcacgacggttattaccacacaggggacatggcatggaaggatgag
gacggctatttctggttcgtgggaagggctgacgacatcatcaagacctcagggtacagg
gtaggaccttttgaagttgagagtgcccttattgagcaccctgcagtactcgaatgtgct
attacaggcgtccctgacccggtaagaggacaggtcatcaaggcaaccattgtgctcacg
agggactatacgacaagcgaggaactgaaaaaagaactccaggaccatgttaagagagtc
actgctccgtacaagtacccccgtgtggtcgagtttgtgaaagaactgccaaagactata
agcggcaagatcagacgtgtggagatacgcgaccacgacaaacaaaagtaa

DBGET integrated database retrieval system