KEGG   Methanolobus psychrophilus: Mpsy_0111Help
Entry
Mpsy_0111         CDS       T02280                                 

Definition
thymidine phosphorylase
Orthology
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
mpy  Methanolobus psychrophilus
Brite
Enzymes [BR:mpy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     Mpsy_0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(109779..111299)
Genome map
AA seq 506 aa AA seqDB search
MQLKVQPIDIKVGKYKVVMNSMDAKELGVYEGDRVRVRNHVTLTAIVDFTEDMIAPGMIG
VYHEVQEQLGKQWTEAVEVEPAEKPKSAHIVRKVMDGKKLDRDEVNLLVRDIVEENLSDV
ELAAFITSTYIRDLSEDETEWLTRAMIETGEQIKFASSPIMDKHSIGGVPGNKITLLIVP
IVAANGLLIPKTSSRAITGAGGTADLMEILAPVDFTAAQIKEMTEKVGGVIVWGGGTNIA
PADDKLIKIEYPLSVDPHCQLLASIMAKKGAVGAQKVVMDIPIGPGTKILDVKAGRKLAR
DLISLGERLGMDVDCALTYGASPIGRTVGPALEVREALKVLETMEGPNSFIEKSVILAGM
LLEMGGAAPRGQGRELALETLRNGKALAKMKEIIAIQGGNPDITHKDIAVGQYTAEILAP
SNGYIIEFYNKRIVHLARSAGAPNDKGSGVLIHKKRGESVEKGQPVLTVYADKKEKLADA
VKYAREFPPIFVEGMLIERVDEIKGL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcagttaaaagtacaacccattgatatcaaggtcggtaaatacaaagttgtgatgaat
tcaatggatgccaaggaacttggtgtctatgaaggtgacagggtcagggtgcgcaatcat
gtcactttaactgcgatcgtggattttaccgaggacatgatagctccgggaatgataggt
gtgtatcatgaggtgcaggagcagctcggcaagcagtggacagaggctgttgaagttgag
cctgcggagaaacccaagtcggcacatattgtcaggaaggtaatggatggcaagaaactg
gaccgggatgaggtaaatctgcttgtcagggacatagtggaagagaaccttagcgatgtt
gagctcgccgcgttcattacatctacttatataagagacctgtcggaggatgagaccgag
tggctgacaagagctatgatcgaaaccggtgagcagataaagttcgcaagttcccccata
atggacaagcactccataggcggggttccgggaaataagataacccttctcatagtcccg
atagttgcagctaacggcctgctcatcccaaagaccagctcacgtgccataaccggggcg
ggaggtaccgctgatctcatggagatacttgcgccagtggactttacggctgcacagatc
aaggaaatgaccgagaaggtcggaggggtcattgtatggggtggcggaaccaacattgca
cctgctgatgacaagctcattaagatagaatacccgctttctgttgatccccattgccag
ctgcttgcatccatcatggctaagaaaggtgctgtcggagctcagaaggtagtcatggac
atacccataggtcccggaacgaagatacttgatgtgaaggccggacgtaaactcgcaagg
gacctcataagcctgggagagcgcctgggcatggatgtggattgcgccctgacctatgga
gcctcgccaattggaaggaccgtgggtcctgcacttgaggtaagggaagccctgaaggtc
cttgagactatggaaggccctaacagctttattgagaagagtgtcattcttgctggcatg
ctgcttgagatgggcggagccgcacctcgcggtcagggtagggaacttgcccttgaaacc
cttagaaatggcaaagctctggcaaaaatgaaagagataatcgcaatacagggcggaaat
cctgacatcacccataaggacatagctgtgggccagtacactgcagagatcctggcacct
tccaatggatacatcatcgaattctacaacaagaggatcgttcatctggcacgttctgca
ggagctcccaatgacaaggggtcaggtgtcctgatacacaaaaagcgcggtgagtccgtg
gagaaaggtcagccggttctcacagtctatgccgacaagaaagagaagcttgcagatgca
gtaaaatatgcaagagagttcccgcccatattcgttgagggtatgctcattgaaagagtg
gatgagatcaagggactctga

DBGET integrated database retrieval system