KEGG   Methanolobus psychrophilus: Mpsy_0486Help
Entry
Mpsy_0486         CDS       T02280                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mpy  Methanolobus psychrophilus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mpy01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mpy00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
481786..482577
Genome map
AA seq 263 aa AA seqDB search
MHSVIHEIIRSTEERVKLISYHHCNKYSSSEKRGIVASIQKKIDEGKVAVISEVKPASPR
RKLKDIPPGDAAAIARLMEEAGAVAISVLTEPQFFRGSLDNLLAVRESVSIPVLRKDFII
NEIQVEEVGSDMILLIVSVLGESVREMVTLVRSKGMEPLVEVHDLEELDIALSTDTRLIG
INNRDLSTLETDLEVTSRLAPLIRKYDAKNGTRHIIISESGISNAADVCKVIEAGADGIL
VGTSIIESDDVYAKTKELVEALR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcattctgttatccatgaaataatcagatcgactgaagaaagagtaaaacttatcagc
taccatcattgcaataaatactcatcttcagagaaaagaggtattgtggcatcaatccaa
aaaaagatagatgaagggaaagtagctgtgatatctgaggtgaagccggcatcaccccgc
aggaaactgaaagatataccccccggggacgcagctgcaatagccaggttgatggaagag
gctggtgctgtggcaatatccgtgctgacagagccgcaatttttcagggggtccctggat
aacctgctggctgtcagagagagtgtcagcattccggtgctgcgcaaggatttcatcatt
aatgagatacaggttgaagaagtaggatctgatatgatattactcatcgtgagcgtcctt
ggggaatcggttagggaaatggtcacgctggtccggagtaaaggaatggagccgctggtc
gaggtccatgatctggaagagcttgatatagccctgtcaacagatacccgcctgataggg
atcaataacagggacctgagcacacttgaaactgaccttgaagttacctcacgcctggca
ccgcttatccgtaagtacgatgccaagaacgggaccagacacatcattattagtgagagc
gggatcagcaatgcagccgatgtatgtaaagtgattgaggccggcgccgacgggatactt
gtcggcacgtccattatcgaaagtgacgatgtttatgcaaaaacgaaagagcttgttgaa
gcactcagatga

DBGET integrated database retrieval system