KEGG   Methanolobus psychrophilus: Mpsy_0487Help
Entry
Mpsy_0487         CDS       T02280                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mpy  Methanolobus psychrophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mpsy_0487
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpsy_0487
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mpsy_0487
Enzymes [BR:mpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mpsy_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
482615..483817
Genome map
AA seq 400 aa AA seqDB search
MKRSMYGRYGGQFVPEVLMPALGELEEAYDTYREDPRFLEELAYYMKEFAGRETPLYFAR
NLSKKYGTKIYLKREDLVHGGAHKLNNTIGQALLAKYMGKKRLIAETGAGQHGTATAMVG
ANMGFETEVYMGAKDVQRQHMNVYRMQLMGTTVHSVQSGSKTLKDAINEALRDWVANVKN
THYLIGSVVGPHPYPMIVRDFQSVIGNEVKRQIMEKEGRYPDSIVACAGGGSNAMGIFHP
FIEDREVRLFPVEAGGCGLKSTDREALHSASLCAGEDGILQGAHTRVLQDRYGQILESSS
VSAGLDYSGVGPELAHLADIGRINPCNVNDEEALEAFYELSRTEGIIPALESSHAISYVM
KMAQSGELGDLVVVSLSGRGDKDLETVFSLKEMEKREGCL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatcgatgtatggacgatatggaggacagttcgtccctgaagtgttgatgccg
gcacttggtgagctggaagaagcttatgatacgtacagagaagatccccgtttccttgaa
gagcttgcctattacatgaaggagtttgccgggagggagactccactatactttgccagg
aacctcagtaagaaatatgggaccaaaatatacctgaagagggaggaccttgtgcatgga
ggagcgcataaacttaataatactatcgggcaggccctcctggcaaaatacatgggcaaa
aagcgcctgatcgcagagacaggagccggacagcacgggactgcaactgccatggtaggg
gcaaacatgggttttgagacggaggtctacatgggggcaaaagatgtgcagagacagcac
atgaacgtttaccgcatgcaacttatgggaactaccgtgcattctgtacaatcaggttca
aagacactcaaggatgctatcaacgaagctctgcgtgactgggtggccaatgtgaagaat
actcactaccttataggctctgttgtgggaccccatccatacccgatgatcgtccgggat
ttccagagcgttatcggaaatgaggtcaaaaggcagataatggaaaaagagggacgctac
cctgattccatagttgcatgtgccggcggcggaagcaatgcaatgggtatattccacccc
ttcattgaggacagggaagtccggttgttcccggtggaagcaggaggatgcggcctgaaa
agcaccgacagggaagcgctgcactcagcatcattatgcgctggcgaggatgggatattg
cagggagcacatacccgggtattgcaggacaggtacggccagatacttgaatcaagttcc
gtttcagcggggctggactactcaggagtcggaccggaacttgctcacctcgcagatatt
ggaagaatcaatccctgcaatgttaacgatgaggaagcgctggaagcgttctacgagctg
agcaggaccgaagggatcatacccgcgctcgaatcgtcacatgccatatcttatgtaatg
aaaatggcgcagagcggggagctgggtgaccttgtagttgtcagtctctccggaagaggg
gacaaggaccttgaaacggttttcagcttaaaggagatggagaaaagagagggttgccta
tga

DBGET integrated database retrieval system