KEGG   Methanolobus psychrophilus: Mpsy_0488Help
Entry
Mpsy_0488         CDS       T02280                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mpy  Methanolobus psychrophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mpsy_0488 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpsy_0488 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mpsy_0488 (trpA)
Enzymes [BR:mpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mpsy_0488 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
483814..484596
Genome map
AA seq 260 aa AA seqDB search
MNIHDKFAQLNEVNEKALIAYVCAGDPGTEATKDIVGALVRGGADIVELGLPFSDPVADG
PTIQAASQRALDAGMNPDRYFKLIASIDAGVPLVCMTYYNLIYKRGLEKFSSDCARSGIS
GIIVPDLPAEESDDLHTACRKHGVDLIFLVTPVTNEARMEKILGKTSGFVYIVSRLGVTG
ARADVAHSTKEILSRVHTDVPKAVGFGISDKEQACEVIAAGADAVIVGSAFVNIIASGEN
VNERVEALASELKQGCRSRN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacatgataagtttgcacaactgaatgaagtgaacgagaaagcccttatagca
tatgtatgtgcaggtgacccgggcactgaagctacaaaggatattgtaggcgcacttgta
cggggcggcgccgatatcgttgaactgggcctgcctttttcagacccggttgccgacggg
cctaccatacaagctgcctcccagcgtgccctggatgcagggatgaaccccgacaggtat
ttcaagctcattgcatcgatcgatgcaggtgtaccgctggtatgcatgacctattacaac
ctcatctacaagaggggactggagaaattctccagtgattgtgccaggtccgggatatca
ggtatcattgtgccggacctgcctgcagaggagtccgatgacctacacacagcctgcagg
aagcatggcgttgacctcatattcctggtcacacccgtgaccaatgaagcaaggatggaa
aagatacttggcaaaacatccgggttcgtatacattgtttccaggctgggggttacagga
gcaagggcagatgtcgcgcattccacaaaagagatactttccagagtacacacggatgtg
ccaaaggctgtaggctttgggatatctgacaaggaacaggcctgtgaagtaatagcagct
ggcgccgatgctgtgatagtaggctctgcttttgtgaacatcatcgcttcgggagagaat
gtgaacgaaagggtcgaagcacttgcaagcgaactgaaacagggatgtagaagcaggaac
taa

DBGET integrated database retrieval system