KEGG   Methanolobus psychrophilus: Mpsy_0671Help
Entry
Mpsy_0671         CDS       T02280                                 

Definition
putative asparagine synthetase, glutamine-hydrolyzing
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mpy  Methanolobus psychrophilus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mpsy_0671
Enzymes [BR:mpy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Mpsy_0671
Peptidases [BR:mpy01002]
 Cysteine Peptidases
  Family C44
   Mpsy_0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(655691..657622)
Genome map
AA seq 643 aa AA seqDB search
MCGKMCGITGFNWKDAKLLKKMCDAIKHRGPDDEGAHVDDTVSLGHRRLSILDLSEKGHQ
PMYSEDGDLVLVYNGEIYNFLEIKEELISKGHHFRSRTDTEVILHCYQEYGTDCVRHFNG
MWAFCIYDRSKNNLFLSRDRFGIKPLYYHYDGSSFIFASEIKALLEHDIPRKENREIIFD
YLYYNLTDHTEDTFFKGIRRLMPGHNLIFDLNTNKMEISRYYDVHDRLTEGANDCGKLKE
IFTDAVRKRLIADVPVGSCLSGGIDSSAIVVTMRKVDPDARIKTFSLRFPDVKINETAYQ
KEVNEMVDSVSYSVTPESSELMRDLEDLFMTQEEPFSGTSVYGQYRVMKLAKDSGVKVLL
DGQGADEVLAGYHYFHGYYYYELLKGFDIPHLMKEANQHYSKSGSLSPMIYLLLRATTDN
MKKLLYKHRKVPFLSQDFIKENHQRKDSRWHLSSLDEALYESLMVYSLPHLLRFEDKNSM
RFSIESRVPFLDYRFVEYAFSMPSEMKIKEGVTKHAFRKAMEGDLPQSILSRYDKIGFAT
PEQKWLRDKAMVELMHKIISSESFKSRDFWNAELVTDMYDKLLSGESSGIFVGTDIWRCI
SVELWMQLYIEKRYSAASVYAALPDTRPVGMVSPREAAVETLT
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtaaaatgtgtgggattacaggatttaactggaaagacgcgaagctacttaaa
aagatgtgcgacgcgataaagcataggggacctgatgatgagggagcccatgttgatgac
actgtgtctctggggcacagaagactgtccatactggacctttcagagaaagggcaccag
ccgatgtacagtgaggatggtgacctggttttggtctataatggggaaatatataacttt
ttggaaataaaagaagaactaatatcaaaaggacatcacttcaggagcaggactgataca
gaagttatactccattgctatcaggaatacggtactgactgtgtccgacatttcaatggg
atgtgggcattctgtatatatgatagatcaaagaacaatctttttttgagccgggacagg
tttggcataaagcctctatattatcactatgacggctcatcattcatcttcgcgtcagag
ataaaggcccttcttgaacacgacatacctaggaaggagaacagggagataatctttgat
tacctgtactataacctgacagatcatacagaggataccttttttaagggtatcagaaga
ctgatgccaggacacaacctcatctttgacctcaataccaataaaatggaaataagcagg
tattacgatgtccatgacaggctgactgaaggtgcaaacgattgtggtaaactgaaagag
atcttcacggatgctgtacgtaagaggctgattgccgatgttcctgtgggcagctgcctg
agcggaggcatcgactcctcagccatcgttgtcacaatgaggaaagttgacccggacgcc
cggataaaaacattttccctgagattcccggatgtgaagataaatgagaccgcttaccag
aaagaggtcaacgaaatggtcgactcggtcagctattctgtgacccctgaatcctccgag
ctcatgcgggaccttgaggatctgttcatgacacaggaagagcccttcagcggaacaagc
gtgtacgggcagtaccgggtcatgaagcttgcaaaggacagcggtgtcaaggtactgctg
gatgggcagggggcggacgaggtactggcagggtatcactatttccatgggtactactat
tacgagctgctaaaaggattcgatattcctcacctgatgaaagaagcaaaccaacactat
tccaaatccggttctctttcaccaatgatatacctgttacttcgtgcgaccactgataac
atgaagaaacttctctacaagcacaggaaggtgcctttcctctcacaggatttcattaaa
gagaaccaccagcgtaaagatagcaggtggcatctgtcatcactggatgaagctctgtac
gaaagccttatggtgtattcacttccgcacttgctgaggtttgaggataagaattccatg
aggttctctatcgagtccagggtacctttccttgactaccgctttgtagagtatgctttt
tccatgccatcggaaatgaagataaaggaaggtgtgaccaagcacgcatttaggaaagct
atggaaggagacctgccgcaaagcatactttcaagatatgataagatcgggtttgcaaca
cctgagcagaaatggctccgggacaaagcaatggttgagctcatgcacaagataataagc
tcagagagcttcaagtcaagggatttctggaacgcggagctggttacagatatgtatgac
aagttattgtccggggaatcgtcaggcatctttgtgggtaccgatatctggcgatgcatt
tctgtcgaattatggatgcagctttacatcgaaaagcggtattctgctgcatccgtgtac
gcagcgctgcctgacaccaggccggtcgggatggtttcacctcgtgaggcagctgttgaa
acattgacataa

DBGET integrated database retrieval system