KEGG   Methanolobus psychrophilus: Mpsy_0752Help
Entry
Mpsy_0752         CDS       T02280                                 

Definition
(GenBank) cellulase
Organism
mpy  Methanolobus psychrophilus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
735907..736953
Genome map
AA seq 348 aa AA seqDB search
MEELITKLSNAHGISGSEGNIRAILEEELRPYVDEMRVDKMGNLITVKKGDGPSIMLAAH
MDEIGLMVKYIDDKGFLRFVKIGGWFDPTLHSQRVIVHTEKGPIPGVIGSKPPHVMKDED
RKKPVNADDMFIDVGANDKEDALNMGIIIGTPVSMDREVKKLANGKITGKAFDNRAGCAI
IIDVMRQISKMDIKATVYAVGTVQEEVGLKGARTSAFGLNPDLAIAIDTTIPGDHPGIDK
KDSVLDIGKGGAITIADAAGRGLIAAPQVVKWLTETAKKNDIPFQTDVGDGGTTDATAIH
LTREGIPSTVVSVATRYIHSPVEVLDVADLKHCSDLIAKAVLSVNDYF
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactgatcactaaattatcaaatgcacacggcatatccggcagcgaagggaac
atccgggcaatccttgaagaggaactcagaccctatgtggacgaaatgagagtggacaag
atgggtaatctcatcacggtcaaaaaaggcgatggcccatcaattatgcttgctgcacac
atggacgagatcgggctcatggtcaagtatatcgacgacaagggcttcctcaggtttgtc
aagatcggaggatggttcgatcccaccctgcacagccagagggtaattgtacataccgag
aaaggtcccataccaggagtcatcggatcaaagcctccgcatgtcatgaaggatgaggac
aggaagaaaccggtcaatgcggatgatatgttcattgatgtaggtgctaacgacaaggaa
gatgcactgaatatgggaatcattataggtacccctgtttccatggaccgtgaggtcaaa
aagctcgcaaacgggaagataaccggaaaggcctttgataacagggcaggctgtgccatt
atcatcgatgtcatgcgccagatatcaaagatggacatcaaagcaacagtctatgcagtc
ggtacagtgcaggaagaagtaggcctcaagggtgccaggacatctgcattcggactcaat
cccgaccttgccatagcgatcgacacgaccatccctggcgaccatccgggaatcgataag
aaggattcagtgctggacatcggcaaaggaggagccatcaccatagcagatgcagcagga
agaggcttgatcgccgcaccgcaagtggtcaaatggcttaccgagacagctaagaagaac
gacatcccattccagacagatgtcggggacggtggcacaacagacgccacagccatccac
cttacaagggaaggcattccctccaccgtggtcagtgttgcaacaaggtacatccattca
ccagtagaggtccttgatgttgccgacctgaagcattgctcagacctcatagcaaaggca
gtgctcagtgtgaatgactatttctga

DBGET integrated database retrieval system