KEGG   Methanolobus psychrophilus: Mpsy_0752Help
Entry
Mpsy_0752         CDS       T02280                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mpy  Methanolobus psychrophilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mpsy_0752
Enzymes [BR:mpy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mpsy_0752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
735907..736953
Genome map
AA seq 348 aa AA seqDB search
MEELITKLSNAHGISGSEGNIRAILEEELRPYVDEMRVDKMGNLITVKKGDGPSIMLAAH
MDEIGLMVKYIDDKGFLRFVKIGGWFDPTLHSQRVIVHTEKGPIPGVIGSKPPHVMKDED
RKKPVNADDMFIDVGANDKEDALNMGIIIGTPVSMDREVKKLANGKITGKAFDNRAGCAI
IIDVMRQISKMDIKATVYAVGTVQEEVGLKGARTSAFGLNPDLAIAIDTTIPGDHPGIDK
KDSVLDIGKGGAITIADAAGRGLIAAPQVVKWLTETAKKNDIPFQTDVGDGGTTDATAIH
LTREGIPSTVVSVATRYIHSPVEVLDVADLKHCSDLIAKAVLSVNDYF
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactgatcactaaattatcaaatgcacacggcatatccggcagcgaagggaac
atccgggcaatccttgaagaggaactcagaccctatgtggacgaaatgagagtggacaag
atgggtaatctcatcacggtcaaaaaaggcgatggcccatcaattatgcttgctgcacac
atggacgagatcgggctcatggtcaagtatatcgacgacaagggcttcctcaggtttgtc
aagatcggaggatggttcgatcccaccctgcacagccagagggtaattgtacataccgag
aaaggtcccataccaggagtcatcggatcaaagcctccgcatgtcatgaaggatgaggac
aggaagaaaccggtcaatgcggatgatatgttcattgatgtaggtgctaacgacaaggaa
gatgcactgaatatgggaatcattataggtacccctgtttccatggaccgtgaggtcaaa
aagctcgcaaacgggaagataaccggaaaggcctttgataacagggcaggctgtgccatt
atcatcgatgtcatgcgccagatatcaaagatggacatcaaagcaacagtctatgcagtc
ggtacagtgcaggaagaagtaggcctcaagggtgccaggacatctgcattcggactcaat
cccgaccttgccatagcgatcgacacgaccatccctggcgaccatccgggaatcgataag
aaggattcagtgctggacatcggcaaaggaggagccatcaccatagcagatgcagcagga
agaggcttgatcgccgcaccgcaagtggtcaaatggcttaccgagacagctaagaagaac
gacatcccattccagacagatgtcggggacggtggcacaacagacgccacagccatccac
cttacaagggaaggcattccctccaccgtggtcagtgttgcaacaaggtacatccattca
ccagtagaggtccttgatgttgccgacctgaagcattgctcagacctcatagcaaaggca
gtgctcagtgtgaatgactatttctga

DBGET integrated database retrieval system