KEGG   Methanolobus psychrophilus: Mpsy_0786Help
Entry
Mpsy_0786         CDS       T02280                                 

Definition
(GenBank) Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
mpy  Methanolobus psychrophilus
Pathway
mpy00500  Starch and sucrose metabolism
mpy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mpsy_0786
Enzymes [BR:mpy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Mpsy_0786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: AFV22995
UniProt: K4MA48
Position
771974..773176
Genome map
AA seq 400 aa AA seqDB search
MRSVCFYFEVHQPYRLKWFWPDSRSAGFGRYFDDNVNREIFRRVAEKCYLPANRTILELI
DENKGNLKLSMSVTGTLLSQCERWGEDVLETFRDLADTGCMEFIDETYYHSLASLFDSGD
EFTDQVMEHRTAMSNLLGVEPQVFRNTELLYNNSIAALAEKMGYKAILMEGIERVLEGRS
PNHVYKAKDGNIAVLLRNYKLSDDIGYRFSSRWWEEYPLTANKWADWVSRSAGETANIFM
DYETFGEHQWADTGIFAFLRALPGEVMDRGVQFLTPSETIGRYAPAGDIDVGDFSTISWA
DIERDTSAWLGNDMQRRCFEEAKLLGPYVKATGDPELLSIWKYLLTSDHYYYMSTKWLGD
GDVHSYFSIHSSPYDAGVNFMAAMMDFKEMVFRKLKEIRH
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagatccgtttgtttttactttgaggtgcatcagccatacaggctcaaatggttctgg
cctgacagcaggtcagcaggatttggaagatatttcgatgacaatgtcaacagggagata
ttcaggagggttgcagagaaatgttatctgcctgcaaaccgcaccatactggaactaatc
gatgagaacaaaggaaacctgaaattgagcatgtctgtcacaggcactctcctgagccag
tgtgaaagatggggagaggatgtgcttgagaccttccgggaccttgcagacacaggatgc
atggagttcatcgacgagacctattatcactcccttgcatcactttttgattcaggtgac
gagttcaccgatcaggtaatggagcaccggacagccatgtcaaacctgctgggcgttgag
cctcaggtgttcaggaacaccgagctgctgtataacaacagcatagctgcccttgctgag
aaaatgggatataaagccatacttatggaaggtatcgaaagggttcttgaaggccggtct
cccaatcatgtctacaaagccaaggatggcaacatagcagtgctgctcaggaactataag
ttaagcgatgatattggttatcgcttttcatcgcgctggtgggaagagtatccgctgact
gcaaataaatgggctgactgggtatcccgcagtgcaggggagacagccaacatcttcatg
gattacgagacattcggagagcaccaatgggcggatacaggcatattcgccttcctgaga
gcgcttcccggagaggtcatggatagaggagtgcaattccttactccttcggagactatc
ggcaggtatgctcctgcaggtgacatcgatgttggggatttctccaccatttcatgggcg
gatatcgaaagagataccagcgcctggcttggtaacgatatgcaacggcgctgcttcgag
gaagcgaaactgcttggaccctatgtgaaagccacaggggatccggagcttctaagcata
tggaaatacttgctgacctcggaccactactattacatgagcacaaaatggctaggcgac
ggtgatgtacactcatatttcagcatccactcctcaccttatgatgcaggggtcaatttc
atggctgccatgatggatttcaaggaaatggtattccggaaattaaaggaaatcaggcat
taa

DBGET integrated database retrieval system