KEGG   Methanolobus psychrophilus: Mpsy_1152Help
Entry
Mpsy_1152         CDS       T02280                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mpy  Methanolobus psychrophilus
Pathway
mpy00330  Arginine and proline metabolism
mpy00332  Carbapenem biosynthesis
mpy01100  Metabolic pathways
mpy01130  Biosynthesis of antibiotics
mpy01230  Biosynthesis of amino acids
Module
mpy_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mpsy_1152
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Mpsy_1152
Enzymes [BR:mpy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Mpsy_1152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AFV23360
UniProt: K4MBE1
Position
1141512..1142654
Genome map
AA seq 380 aa AA seqDB search
MINRKELFSGLNKIVVKIGTSSISTEDGKLNHRFMDGMASQVAALHEQGRQVILVSSGAI
GIGIDILGFGCRPREIPVRQACAAVGQSVLMQEWSNSFGKHDLKVAQILLTYESFSNRLT
YLNLRNSISTLLSYGVIPIINENDTVCVNEIEATFGDNDKLSAVVASKTEADLLIILSDI
DGLYDKNPKRNDDAHMISVIEEITPEVESYGGSPTSMKGVGGMRTKIEAAKICHMAGCNM
IIANSSTEDVVRRVLGGEDIGTLFLANQEVHRNRIRWIILSRSSGSVDVDEGARAAIMDS
MSLLPSGVLNVKGSFDRGDIIEIRCGEEIFAKGITDYTSEELEQIKGKHTNQIVDILGYK
NYNNVVKKENIGLFNHSEKH
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaacaggaaagagctctttagcggtcttaacaagatagtggtgaaaataggtacg
tcttccatcagtaccgaggatggaaaactcaatcaccggttcatggacggtatggcctcc
caggttgctgctctgcatgagcagggcaggcaggtcatccttgtgagttccggagctatc
ggcataggtatcgatatactgggctttggatgccgtcccagggaaatacctgtcaggcaa
gcctgtgcggctgtaggacagagtgtgcttatgcaggagtggagcaattcatttggcaag
catgacctcaaggtggctcagatactgttgacatacgagtcattctcaaaccggctcact
taccttaacctgaggaacagcatttccacactgcttagctacggagtcattccaatcatt
aatgaaaatgacactgtatgtgtcaatgagatagaggcaaccttcggtgacaacgacaaa
ctttcagcagtggtcgcaagcaaaacagaagcagacctgctcataatactttccgacatc
gacggcctctacgataagaaccccaagcgcaatgatgatgcacatatgataagtgtcatt
gaggagatcacccccgaagtagagagctatggaggcagccccacaagcatgaaaggtgtc
ggcgggatgcgcacaaagatagaggctgccaagatctgccacatggccggctgcaatatg
ataattgcgaacagcagcaccgaagacgtcgtcaggagagtgctcggcggcgaagatatc
ggcacgctgttccttgcaaaccaggaagtgcacaggaacaggatacgctggataatactc
tcaagatcatcaggctctgtagatgtagacgaaggcgcaagggctgctataatggatagc
atgagcctgcttccctcaggcgtgctcaatgtcaaaggcagttttgacaggggcgatata
atagagatcaggtgcggggaagaaatattcgcgaagggtataaccgactatacatccgaa
gaactggagcagatcaagggaaaacataccaaccagatagttgacatacttggttacaag
aactataacaatgttgtcaaaaaggagaacataggactatttaatcattcagagaagcat
tga

DBGET integrated database retrieval system