KEGG   Methanolobus psychrophilus: Mpsy_1424Help
Entry
Mpsy_1424         CDS       T02280                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpy  Methanolobus psychrophilus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpsy_1424
   01230 Biosynthesis of amino acids
    Mpsy_1424
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpsy_1424
   00051 Fructose and mannose metabolism
    Mpsy_1424
   00562 Inositol phosphate metabolism
    Mpsy_1424
Enzymes [BR:mpy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mpsy_1424
Exosome [BR:mpy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mpsy_1424
  Exosomal proteins of bladder cancer cells
   Mpsy_1424
  Exosomal proteins of melanoma cells
   Mpsy_1424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1405915..1406586)
Genome map
AA seq 223 aa AA seqDB search
MSSTLIVLNLKTYLEGTGEGAVKIAQACRQVAEDSGIDIAVAPQFCDIYRVSSQVDIPVY
AQHLDSVGAGGFTGHAFAQCIKDAGAVGTLINHSEYRLTLANIDASVSRVKETGLTSIVC
TNNVPTSAAAAALGPDYVAVEPPELIGSGIPVSKADPQVITGSVEAVKRVNPAVKVLCGA
GISKGEDLLAALELGSVGVLLASGIVKAKDPKVALEDLVSKIR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagttccacactgatagttttgaacctgaagacataccttgaaggcacaggcgaaggc
gccgtaaagatagcgcaggcatgcaggcaagttgctgaagattccggcatagatattgcg
gtggcaccccagttctgtgatatttatcgtgtatcctcgcaggtggatatccctgtttat
gcgcagcatctggatagcgtaggagcagggggttttacaggacatgctttcgctcagtgc
ataaaggatgcgggggcagttggcactctcattaaccactccgaataccgcctgacactg
gcaaacattgatgcatctgtaagcagagttaaagaaaccggccttacaagtatcgtatgt
actaacaatgtgcctacttctgcagcagccgcagctctgggtcctgattacgtggcagtg
gagccgccggaacttatcggcagcggaataccggtgtcaaaagcagacccgcaggtgatc
acaggttccgtggaagctgtcaaaagagtgaaccctgccgttaaagtgctgtgtggggca
ggcatatcaaaaggagaggatctccttgcagctcttgagcttggttccgtgggtgtcctg
ctggcctcaggcattgttaaagctaaggatcccaaggttgcgcttgaagaccttgtaagc
aagatcagataa

DBGET integrated database retrieval system