KEGG   Methanolobus psychrophilus: Mpsy_1578Help
Entry
Mpsy_1578         CDS       T02280                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
mpy  Methanolobus psychrophilus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpsy_1578
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mpsy_1578
Enzymes [BR:mpy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Mpsy_1578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1558866..1560605
Genome map
AA seq 579 aa AA seqDB search
MNMFGWTGRTVIIDLESNSVTESRTTKKDAEQFIGGRGLGCRLMADLADPGIEPLSPGNP
LIFSTGPLTGTSAPMSGHFNITTKSPLTGTISDSNAGGHLGAEMKFAGVDSLIVLGKAAE
PAYIRIEDEDVEILPAGHLWGKSTAEIVSILEFQGKVACIGKAGERLVALANIVSGGYPS
GRGGHGAVAGSKNLKAVVVKGSNLPEIAEPKAFGKAVEKVNRLLIANPPASKGLANYGTA
VFADLLGHMGILPADNFRKKGSHEADKISGEFIMDNYRTEKEPCYACPVGCRRDFDNGSP
VPDYDSLWTFGPNIGNTDLDTITLLNRMCVDYGMDPISCGSAVAAYMELHSVRLGKEELV
ALVRDIGEGRSELSAGSYLYMCSKGTRQNSMSVKGLDLPGYDPREMAGMALAYATSNRGG
CHLSAFMAAPEIMGKPVALNRLKFDGKAALVQYFQNLAAVIDSLVICPYAAFAMGEVELA
SLLSTATGKSYTAEELLRAGERIYNLERMYNIKTGFSRKDDTLPERFFGEDGIDRELFGN
TLTDYYHFRGWDETGVPSKEKLQELGIWEEKAGKDSGGR
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgttcggatggaccggaaggacagtaatcatagaccttgagagtaactcggtc
actgaatcgaggacaacgaaaaaggatgcagaacagttcatcggagggcgtggcctggga
tgccggctcatggcggacctggctgaccctgggatagaacccctgagtccgggaaatcca
cttatcttcagcaccgggccgctgacaggaacctctgcgcccatgtcaggacacttcaac
ataacaacaaagtcacccctgacagggacaatatctgactccaacgcaggaggtcatctc
ggggcggagatgaagttcgcaggtgtggattccctgatagtgctgggaaaagctgcagaa
ccggcctatatccgaatagaggatgaggatgttgagatactgccagctggccacctttgg
ggaaaaagtaccgctgaaatagtatccattcttgagtttcagggaaaggtggcatgtata
ggtaaagcaggagaaaggctggtcgcgcttgcaaacatagtgagtggtggctatccctcc
gggcgcggcgggcacggggctgtggccgggtcaaagaacctcaaggcggttgttgtgaag
ggaagcaaccttccggagatagcagagccaaaagcctttggaaaagcagtggagaaggtc
aacaggctgctgatcgcaaatccaccggcatcaaagggccttgccaattacggaacagca
gtctttgctgacctgttaggccacatggggatactgcctgcggacaatttcaggaaaaag
gggtcccatgaagcggacaagatctcgggcgagttcatcatggacaattaccgaaccgaa
aaagagccatgttatgcctgccctgtcgggtgcaggagggattttgataatggctctccc
gtgccggactatgattcactctggacatttgggccgaatataggcaatactgatctggat
actatcactttgctcaacagaatgtgtgtcgactatggcatggatcccatttcatgtgga
tctgccgttgcggcatacatggagctgcactccgtcaggcttggaaaagaagaacttgtt
gcactggtcagggatattggggaagggagaagcgaactttctgcaggttcatacttatat
atgtgctcaaaaggaacgcggcagaacagtatgagcgtcaaggggcttgacctcccggga
tatgatccccgggaaatggcagggatggcacttgcctatgcgacatccaacaggggagga
tgtcatctgagtgcattcatggcggcaccggagataatgggaaaaccggtggctctcaac
aggcttaagtttgacggcaaggcagctcttgtccagtatttccagaaccttgcggcagtg
atcgactcgcttgttatctgcccttatgcagcttttgcgatgggagaggtggaacttgct
tccctcctcagcactgcaaccggaaaatcctatactgccgaggaactgctgcgtgcggga
gagcgcatatacaatctggagagaatgtacaatatcaagaccggattttcaagaaaagat
gatacattgcctgaaagattcttcggggaagatggcattgacagggagctgttcggaaat
accctgaccgattattatcatttcagaggctgggatgagacaggagtgccttcaaaggaa
aaattacaggaactgggcatttgggaagaaaaagcagggaaggattccgggggaagatag

DBGET integrated database retrieval system