KEGG   Methanolobus psychrophilus: Mpsy_1580Help
Entry
Mpsy_1580         CDS       T02280                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mpy  Methanolobus psychrophilus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mpsy_1580
Enzymes [BR:mpy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mpsy_1580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1561207..1562076
Genome map
AA seq 289 aa AA seqDB search
MFHKPEMMDALSDYGSARYVIFGVPFDGTSSYRSGSRWAPDAMRQASANFETYNAYFDVD
YEDLQIHDAGNLEHYTTVEQTLEELALAVEPIVADGKIPIMLGGEHSLTLPCVKACAKQA
GDDFGVVVLDAHFDLRPEYGGVKYNHACVSRHILDEITDNYVTIGVRSGPKEEWVFAKDN
DIRYYTPDDVREKGIRKVLAEVTDYLGCSQIYLSLDMDALDPAYAPGLGTPEPFGLSDIE
VREVIHRLAPMSVGFDIMEIAPEYDNGQSALLGTKLLREFIAAHAASER
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgttccataaacctgagatgatggatgccctgtcagactatggctctgccaggtatgtt
atattcggtgtgccttttgacgggacatcatcgtacaggtcaggaagccgatgggcgccg
gacgccatgagacaggcatctgcaaattttgaaacgtataacgcttactttgacgtggat
tacgaggatctgcagatacatgatgcaggcaacctcgaacactacacaacagtagagcag
acgcttgaagagcttgctcttgcagtcgagcccatcgttgcagacggaaagatccctatt
atgcttggaggagagcattcgcttactcttccctgcgtgaaagcctgtgcaaaacaggca
ggtgatgactttggcgttgtggtactggatgcccactttgacctccgtccggagtacggc
ggtgtcaaatacaatcatgcatgcgtatcaagacacatcttggatgagatcaccgataac
tacgtgacaatcggggtacgcagcgggccaaaggaagaatgggtgtttgcaaaagataat
gatatcaggtactatactcctgacgatgtacgcgagaaaggtatcaggaaggtacttgca
gaggttaccgactacctgggctgctcgcagatatacctctccctggatatggatgccctc
gaccctgcatacgcgcctggcctcggtacacctgaaccctttggtcttagcgacattgag
gtccgtgaagtgatacacaggcttgcacctatgagcgtgggctttgatatcatggaaata
gcgccggaatatgacaacgggcaaagcgcgctgcttggcacgaaactgctgagggaattc
atcgcggcacatgctgcaagtgagagatag

DBGET integrated database retrieval system