KEGG   Methanolobus psychrophilus: Mpsy_1584Help
Entry
Mpsy_1584         CDS       T02280                                 

Definition
L-isoaspartyl protein carboxyl methyltransferase (pcm-2)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mpy  Methanolobus psychrophilus
Brite
Enzymes [BR:mpy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mpsy_1584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1563090..1563365
Genome map
AA seq 91 aa AA seqDB search
MELIRCDGSLGYEQEAPYDRICVTACAPALPQVLMEQLKAGGLIVIPEGEACQRLYLYRK
WEEGKVVKEDWGGVFFVLLIGEHGFRFVTQP
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
gtggagcttatccggtgtgatggctcccttggatatgaacaggaagcaccttatgacagg
atatgtgtaacagcctgcgctcctgccctgccgcaagtccttatggagcagctcaaagcc
ggcggactgatagtaatacctgagggagaggcttgccagcggctgtacctttacagaaaa
tgggaggaaggcaaggttgtgaaggaagactggggaggagtgttcttcgtgcttctaatt
ggcgagcacggcttcaggttcgtcacacaaccctga

DBGET integrated database retrieval system