KEGG   Methanolobus psychrophilus: Mpsy_1765Help
Entry
Mpsy_1765         CDS       T02280                                 

Definition
pyruvate synthase, alpha subunit
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mpy  Methanolobus psychrophilus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpsy_1765
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpsy_1765
   00020 Citrate cycle (TCA cycle)
    Mpsy_1765
   00620 Pyruvate metabolism
    Mpsy_1765
   00640 Propanoate metabolism
    Mpsy_1765
   00650 Butanoate metabolism
    Mpsy_1765
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpsy_1765
   00680 Methane metabolism
    Mpsy_1765
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mpsy_1765
Enzymes [BR:mpy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mpsy_1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1732010..1733224)
Genome map
AA seq 404 aa AA seqDB search
MAHEMKMDKKNMVVVEGSYAVAHAVKTCRPNVISAYPITPQTHIVEDLSKFMADGEIPNC
EYINVESEFSALSALVGSSAVGARSYSATTSQGLELMHEVLFNVAGMRLPIIMTVANRAV
SAPINIWNDHQDSISQRDTGWIQLYAENTQEISDMTAQAFKISEDRDIMMPSMTCMDGFI
LSHVYEPLVLLEQDITDEFLPPFRPERILDPKNPMTFGAFADPHFYTEFRYQQERAMQNS
LKKIEDVANEFYDMYGRYFGGLIDEYQTEDADIIIMAMGSIIGTIKDVIDHLREKNVKIG
LLKVRAFRPFPAQAIMNVIKDAKVVVVLDKNISLGMNAGALFIETKSVLYNTDIDVPVIG
YMIGQGGRDIPMSTIEKIISDAEEVMRSGIKIESQFTDLKEELL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggctcatgaaatgaagatggataagaaaaacatggtcgttgtggaaggttcctatgct
gttgcacatgcagtcaagacctgcaggccaaatgtgatctccgcatatcctattaccccg
cagacacacattgtggaagatctttccaagttcatggcagacggagagataccaaactgc
gagtacattaacgtagagtctgaattctcagcactttcagcactggtgggctcatcagca
gtcggagcaagatcctactcagccacaacgtcccagggacttgaactcatgcacgaggtt
ctgttcaacgtggccggtatgagacttccgataattatgaccgttgcaaacagggcagtc
agtgctccgatcaacatatggaatgatcaccaggactcgatatcccagagggacacggga
tggatccagctctacgccgaaaacacccaggaaatttccgatatgaccgcacaggctttc
aagatatctgaggacagggatataatgatgccttcgatgacctgtatggacggcttcatc
ctttcacatgtctatgagcctctggtgctccttgaacaggatatcactgacgagttcctg
ccacctttcaggccggagcgtatccttgacccgaagaatcccatgacatttggtgcattc
gcagacccgcacttctacactgagttcagataccagcaggagcgcgccatgcagaactcc
ctcaagaagattgaggatgtcgcaaacgaattctacgacatgtacggcaggtacttcgga
gggcttatcgatgaataccagaccgaggacgcagacatcataataatggctatgggctct
atcatcgggactatcaaggatgttattgaccacctcagggagaagaacgttaagatagga
ctgctcaaggtcagggcgttccgacctttcccggcccaggccataatgaatgtcattaag
gatgctaaggtcgtcgttgtgcttgacaagaacatctcgcttggtatgaatgcaggcgcc
ctgttcattgaaacgaaatcggttctctacaacactgatatcgatgttcccgtcataggc
tacatgataggccagggcggacgtgacatacccatgagcactattgaaaagataatctct
gatgcagaggaagtaatgagatcgggtatcaagatagagagccagtttaccgacctgaag
gaggaactgttatga

DBGET integrated database retrieval system