KEGG   Methanolobus psychrophilus: Mpsy_1766Help
Entry
Mpsy_1766         CDS       T02280                                 

Definition
(GenBank) pyruvate synthase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mpy  Methanolobus psychrophilus
Pathway
mpy00010  Glycolysis / Gluconeogenesis
mpy00020  Citrate cycle (TCA cycle)
mpy00620  Pyruvate metabolism
mpy00633  Nitrotoluene degradation
mpy00640  Propanoate metabolism
mpy00650  Butanoate metabolism
mpy00680  Methane metabolism
mpy00720  Carbon fixation pathways in prokaryotes
mpy01100  Metabolic pathways
mpy01120  Microbial metabolism in diverse environments
mpy01130  Biosynthesis of antibiotics
mpy01200  Carbon metabolism
Module
mpy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpsy_1766
   00020 Citrate cycle (TCA cycle)
    Mpsy_1766
   00620 Pyruvate metabolism
    Mpsy_1766
   00640 Propanoate metabolism
    Mpsy_1766
   00650 Butanoate metabolism
    Mpsy_1766
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpsy_1766
   00680 Methane metabolism
    Mpsy_1766
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mpsy_1766
Enzymes [BR:mpy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mpsy_1766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_7 Fer4_6 Fer4_2 Fer4_9 Fer4_16 Fer4_10 Fer4_17 Fer4_15 Fer4_4 Fer4_13 Fer4_8 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AFV23973
UniProt: K4MCU9
Position
complement(1733224..1733484)
Genome map
AA seq 86 aa AA seqDB search
MKIVPGAVCEAGTSRVNKTGGWRTFKPVYDYDKCIKCKLCELLCPDSSVKPREDGYFEFD
YDYCKGCGICANECPKSAITMVLEEK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatagttcccggagccgtttgcgaggcaggtaccagcagggtcaataagaccggc
ggatggaggaccttcaagcctgtttacgattacgacaaatgcataaaatgcaagttatgc
gagttactgtgtcctgacagttcagtgaaaccaagggaagacggctacttcgaattcgat
tatgattactgcaagggatgcggcatatgtgccaacgaatgccccaagagcgctatcacg
atggtcctggaggaaaaataa

DBGET integrated database retrieval system